Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39530 46 / 9e-07 Uncharacterised protein family (UPF0497) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031303 [exp] 179 / 2e-58 AT2G39530 87 / 2e-21 Uncharacterised protein family (UPF0497) (.1) Lus10031304 [exp] 125 / 6e-37 AT2G39518 89 / 3e-22 Uncharacterised protein family (UPF0497) (.1) Lus10031305 [exp] 108 / 1e-30 AT2G39530 89 / 3e-22 Uncharacterised protein family (UPF0497) (.1) Lus10031874 [exp] 107 / 6e-30 AT2G39530 92 / 1e-23 Uncharacterised protein family (UPF0497) (.1) Lus10031875 [exp] 91 / 2e-23 AT2G39530 86 / 4e-21 Uncharacterised protein family (UPF0497) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G040100 [exp] 45 / 2e-06 AT2G39518 79 / 1e-18 Uncharacterised protein family (UPF0497) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031873 pacid=23180715 polypeptide=Lus10031873 locus=Lus10031873.g ID=Lus10031873.BGIv1.0 annot-version=v1.0 ATGACTTGTTCACAGAGTGGATCATCATCGAATGTCGTCCTGGTTCTCCGACTCGCAACCATGTTCCTTCTGGTGGGAGCTGTTATGGTTCTGGTGTTCA ACAGTGTTACAGTCACACTTGATCTCAGGACCTTCACCATCACGTTCCCGCCCCCCAAGCTCACTTTCAAGGACCTCATCACCTTCAAGTACATGCTTTC CGGTGCTTTCGATTTCTACGCAGAGCAGGTAGTTACCTACCTGCTAGCTACGGCAGTCGGTGCAGGGTTTCTCGTCTGTGGGGAGCTCAAGATCAATCTG ACCAAGATGATAAACTCCCTTGAAGAAGTGATCACAGAAGGGCTCGAGGATTCGCGCAATACAACAAGTTTGTCAACTATGGATTCATAG
AA sequence Show only first row Show all	>Lus10031873 pacid=23180715 polypeptide=Lus10031873 locus=Lus10031873.g ID=Lus10031873.BGIv1.0 annot-version=v1.0 MTCSQSGSSSNVVLVLRLATMFLLVGAVMVLVFNSVTVTLDLRTFTITFPPPKLTFKDLITFKYMLSGAFDFYAEQVVTYLLATAVGAGFLVCGELKINL TKMINSLEEVITEGLEDSRNTTSLSTMDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10031873 [exp]	0	1
AT3G13040	GARP		myb-like HTH transcriptional r...		Lus10028102 [exp]	1.0	0.9541
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10002638 [exp]	1.4	0.9524
AT2G39530			Uncharacterised protein family...		Lus10031303 [exp]	1.7	0.9498
AT1G18390			Protein kinase superfamily pro...		Lus10027117 [exp]	4.2	0.9129
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10018138 [exp]	5.0	0.9429
					Lus10004778 [exp]	5.3	0.9368
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10023850 [exp]	5.5	0.9419
AT5G62670		AHA11	H\(+\)-ATPase 11, H\(+\)-ATPas...		Lus10028203 [exp]	6.0	0.9435
AT2G34930			disease resistance family prot...		Lus10001035 [exp]	6.2	0.9213
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10042904 [exp]	6.3	0.9365

Compare expression of checked genes

Lus10031873 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.