Lus10031889 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24780 119 / 1e-32 Pectin lyase-like superfamily protein (.1.2)
AT3G27400 116 / 1e-31 Pectin lyase-like superfamily protein (.1)
AT1G67750 113 / 1e-30 Pectate lyase family protein (.1)
AT4G13210 112 / 3e-30 Pectin lyase-like superfamily protein (.1.2)
AT5G63180 111 / 7e-30 Pectin lyase-like superfamily protein (.1)
AT3G07010 111 / 7e-30 Pectin lyase-like superfamily protein (.1)
AT4G13710 111 / 1e-29 Pectin lyase-like superfamily protein (.1.2)
AT5G48900 110 / 2e-29 Pectin lyase-like superfamily protein (.1)
AT3G24670 108 / 8e-29 Pectin lyase-like superfamily protein (.1)
AT1G04680 103 / 5e-27 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011400 133 / 4e-38 AT1G67750 623 / 0.0 Pectate lyase family protein (.1)
Lus10006456 132 / 2e-37 AT1G67750 625 / 0.0 Pectate lyase family protein (.1)
Lus10013668 115 / 3e-32 AT5G63180 424 / 2e-149 Pectin lyase-like superfamily protein (.1)
Lus10013667 114 / 4e-32 AT5G63180 469 / 4e-167 Pectin lyase-like superfamily protein (.1)
Lus10036946 116 / 1e-31 AT5G63180 627 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10033037 115 / 5e-31 AT5G63180 671 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10014887 112 / 4e-30 AT5G63180 620 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10022310 112 / 4e-30 AT5G63180 626 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10042509 107 / 9e-30 AT4G13710 367 / 3e-127 Pectin lyase-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G339500 120 / 3e-33 AT4G24780 617 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Potri.008G182200 120 / 3e-33 AT1G67750 671 / 0.0 Pectate lyase family protein (.1)
Potri.012G091500 117 / 7e-32 AT4G24780 645 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Potri.010G051800 116 / 1e-31 AT1G67750 645 / 0.0 Pectate lyase family protein (.1)
Potri.015G087800 115 / 3e-31 AT5G63180 657 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.008G148800 105 / 2e-27 AT5G15110 523 / 0.0 Pectate lyase family protein (.1)
Potri.006G196400 97 / 5e-27 AT4G24780 184 / 3e-58 Pectin lyase-like superfamily protein (.1.2)
Potri.002G238800 103 / 1e-26 AT3G07010 655 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.014G178100 103 / 1e-26 AT3G07010 652 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.003G175900 102 / 2e-26 AT4G13710 681 / 0.0 Pectin lyase-like superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00544 Pectate_lyase_4 Pectate lyase
Representative CDS sequence
>Lus10031889 pacid=23180564 polypeptide=Lus10031889 locus=Lus10031889.g ID=Lus10031889.BGIv1.0 annot-version=v1.0
ATGTCAAGGTGTCGGCATGGGTACTTCCACGTGGTGAACAATGACTACACTCATTGGCTAATGTATGCAATTGGTGGGAGTGCTTCTCCAACCATCAATA
GCCAAGGGAATAGGTTCCTGGCACCAAATGATAGATTCAACAAAGAGGTGACGAAACGGGAGGACGCGGGGGAGAGCGAGTGGAAGAAGTGTCGGAAGGG
GACCTATTGCTCAACGGTGCATTCTTCACAAGGTCCGGAGCCGGAGCATCATCGAGCTATGCTCTTGTGGGACAAGAGCTTTTGGGGGAAGATGGGATTT
GTGCATTGTGGTAAAGATTTGATCTTTGTAAAACTTATAATTCAAGCATATAAATGGAGACAACGGTCTATACCGGTTTTCGACGATAAGTCGTATCGTA
CTAACGAACCTTCGAATCATGCCCCGTAG
AA sequence
>Lus10031889 pacid=23180564 polypeptide=Lus10031889 locus=Lus10031889.g ID=Lus10031889.BGIv1.0 annot-version=v1.0
MSRCRHGYFHVVNNDYTHWLMYAIGGSASPTINSQGNRFLAPNDRFNKEVTKREDAGESEWKKCRKGTYCSTVHSSQGPEPEHHRAMLLWDKSFWGKMGF
VHCGKDLIFVKLIIQAYKWRQRSIPVFDDKSYRTNEPSNHAP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G24780 Pectin lyase-like superfamily ... Lus10031889 0 1

Lus10031889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.