Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53480 97 / 2e-24 ARM repeat superfamily protein (.1) AT3G08943 65 / 2e-13 ARM repeat superfamily protein (.1) AT3G08947 62 / 2e-12 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041453 [exp] 116 / 3e-31 AT5G53480 1334 / 0.0 ARM repeat superfamily protein (.1) Lus10034318 [exp] 115 / 4e-31 AT5G53480 1332 / 0.0 ARM repeat superfamily protein (.1) Lus10023247 [exp] 99 / 3e-25 AT5G53480 509 / 3e-172 ARM repeat superfamily protein (.1) Lus10008863 [exp] 99 / 5e-25 AT5G53480 1443 / 0.0 ARM repeat superfamily protein (.1) Lus10008864 [exp] 97 / 1e-24 AT5G53480 1443 / 0.0 ARM repeat superfamily protein (.1) Lus10023246 [exp] 97 / 1e-24 AT5G53480 1449 / 0.0 ARM repeat superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G017500 [exp] 102 / 2e-26 AT5G53480 1531 / 0.0 ARM repeat superfamily protein (.1) Potri.015G010400 [exp] 102 / 2e-26 AT5G53480 1547 / 0.0 ARM repeat superfamily protein (.1) Potri.016G123600 [exp] 64 / 4e-13 AT3G08943 1288 / 0.0 ARM repeat superfamily protein (.1) Potri.006G103300 [exp] 64 / 8e-13 AT3G08943 1294 / 0.0 ARM repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031905 pacid=23180709 polypeptide=Lus10031905 locus=Lus10031905.g ID=Lus10031905.BGIv1.0 annot-version=v1.0 ATGCATATTCGAGGGATTCTTCGAGGTTTTAAGGGCACGCCGAAGTGCCAGCTCTTGATTCCTTATGGATCAGACGTTGTCAAGTATTTGGAGAGCATAT ACAAGGGGAAGGACATGGATGCCTTGGTGATGAAGGCAGCTATCAGTGTACTTGGTGATCTCGCGGATACGCTCGGAAGTCGTGGTGGTTGTTTGATAGA GCAGTCCCGTTTATGTAGAGAATTGTTGAATGAATGTTTGTCATCCGCAGACGAGAGTATCGAAGAATCCGCAGACGAGAGTATCGAAGAATCTGCTGAG CAGTCCAAGTTGGCGATCGCAAAGGCTGGGATCGGTTTAGAATGCAGGATGTAG
AA sequence Show only first row Show all	>Lus10031905 pacid=23180709 polypeptide=Lus10031905 locus=Lus10031905.g ID=Lus10031905.BGIv1.0 annot-version=v1.0 MHIRGILRGFKGTPKCQLLIPYGSDVVKYLESIYKGKDMDALVMKAAISVLGDLADTLGSRGGCLIEQSRLCRELLNECLSSADESIEESADESIEESAE QSKLAIAKAGIGLECRM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53480			ARM repeat superfamily protein...		Lus10031905 [exp]	0	1
AT3G05550			Hypoxia-responsive family prot...		Lus10015191 [exp]	1.0	0.7617
AT3G57990			unknown protein		Lus10000401 [exp]	4.5	0.7018
AT5G03250			Phototropic-responsive NPH3 fa...		Lus10009292 [exp]	5.5	0.6839
AT4G16640			Matrixin family protein (.1)		Lus10037419 [exp]	11.0	0.6830
AT1G31550			GDSL-like Lipase/Acylhydrolase...		Lus10026550 [exp]	12.4	0.6802
AT1G15550		ATGA3OX1, GA4	GA REQUIRING 4, ARABIDOPSIS TH...		Lus10013135 [exp]	13.9	0.6802
					Lus10010827 [exp]	15.0	0.6802
					Lus10022511 [exp]	16.0	0.6802
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Lus10024231 [exp]	17.0	0.6802
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Lus10036381 [exp]	17.9	0.6802

Compare expression of checked genes

Lus10031905 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.