Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46140 86 / 2e-20 Protein kinase superfamily protein (.1) AT3G45790 79 / 5e-18 Protein kinase superfamily protein (.1) AT3G50310 77 / 3e-17 MKKK20, MAPKKK20 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) AT4G26890 77 / 3e-17 MAPKKK16 mitogen-activated protein kinase kinase kinase 16 (.1) AT3G46160 77 / 5e-17 Protein kinase superfamily protein (.1) AT1G09000 77 / 6e-17 MAPKKK1, ANP1 MAP KINASE KINASE KINASE 1, NPK1-related protein kinase 1 (.1) AT5G55090 76 / 1e-16 MAPKKK15 mitogen-activated protein kinase kinase kinase 15 (.1) AT1G54960 76 / 1e-16 MAPKKK2, ANP2 MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASES 2, NPK1-related protein kinase 2 (.1) AT3G06030 75 / 2e-16 AtANP3, MAPKKK12, ANP3 NPK1-related protein kinase 3 (.1) AT2G42550 73 / 6e-16 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031338 [exp] 212 / 1e-71 AT3G46160 77 / 4e-17 Protein kinase superfamily protein (.1) Lus10029047 [exp] 111 / 7e-32 AT3G50310 93 / 5e-23 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Lus10026894 [exp] 114 / 1e-31 AT3G50310 187 / 1e-57 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Lus10029019 [exp] 109 / 3e-31 AT3G50310 96 / 3e-24 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Lus10039141 [exp] 109 / 2e-29 AT3G46140 168 / 1e-49 Protein kinase superfamily protein (.1) Lus10034288 [exp] 108 / 2e-29 AT3G50310 181 / 5e-55 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Lus10029023 [exp] 107 / 2e-29 AT3G50310 147 / 8e-43 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Lus10034242 [exp] 107 / 6e-29 AT3G50310 190 / 2e-58 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Lus10034285 [exp] 106 / 2e-28 AT5G27510 183 / 6e-56 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G139300 [exp] 81 / 9e-19 AT5G67080 329 / 6e-112 mitogen-activated protein kinase kinase kinase 19 (.1) Potri.009G131100 [exp] 81 / 1e-18 AT3G50310 200 / 4e-62 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Potri.007G044800 [exp] 80 / 2e-18 AT5G67080 350 / 6e-120 mitogen-activated protein kinase kinase kinase 19 (.1) Potri.012G143900 [exp] 78 / 2e-17 AT1G63700 766 / 0.0 YODA, MAP KINASE KINASE KINASE 4, EMBRYO DEFECTIVE 71, Protein kinase superfamily protein (.1) Potri.007G106800 [exp] 77 / 6e-17 AT1G53570 582 / 0.0 MAP KINASE KINASE KINASE 3, mitogen-activated protein kinase kinase kinase 3 (.1.2.3.4.5) Potri.005G062500 [exp] 76 / 1e-16 AT1G53570 566 / 0.0 MAP KINASE KINASE KINASE 3, mitogen-activated protein kinase kinase kinase 3 (.1.2.3.4.5) Potri.005G139200 [exp] 74 / 4e-16 AT5G67080 305 / 2e-102 mitogen-activated protein kinase kinase kinase 19 (.1) Potri.015G146700 [exp] 74 / 6e-16 AT1G63700 826 / 0.0 YODA, MAP KINASE KINASE KINASE 4, EMBRYO DEFECTIVE 71, Protein kinase superfamily protein (.1) Potri.001G102900 [exp] 74 / 7e-16 AT1G63700 868 / 0.0 YODA, MAP KINASE KINASE KINASE 4, EMBRYO DEFECTIVE 71, Protein kinase superfamily protein (.1) Potri.005G172200 [exp] 74 / 7e-16 AT4G08500 421 / 6e-141 MAPK/ERK kinase kinase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10031910 pacid=23180691 polypeptide=Lus10031910 locus=Lus10031910.g ID=Lus10031910.BGIv1.0 annot-version=v1.0 ATGAACGACTACTACCAGTGCGTTGGGGACTACAGAGGGACTGCCAGGTACATGCCGCCGGAGATGGTGAACGTCAAGAAGGTTTCCCCCGCGATGGACG TGTGGGCGCTTGGGTGCACGGTTCTCGAGATGCTGACCGGCAATCGCCCGTGGAAAGGGTGGAGTGGTAAGGAAGAGGAGCTGGAGGTTGAGATCGGGAG AGGCCGTCATCCGGTGATTCCGGATTGGCTTTGTGAGGAAGCCAAGGATTTCTTGGGGATGTGCTTTGAGAATAGCTGGCTTCGGCGGGCGAATTGTTGG GATCTGCTCAGGCATCCGTTCGCGGGCGGCAGACTGCGCGTTGAGGCGCAGCTGTCGGAGCCGGTGAAGATAAGGGTGCCGGAGCCGGTGGAGGAGGCTA GGATTCCTAATCACCTTTTACTTCCTCATTTGATGTTTGACGAATTAAATCTGGATTAA
AA sequence Show only first row Show all	>Lus10031910 pacid=23180691 polypeptide=Lus10031910 locus=Lus10031910.g ID=Lus10031910.BGIv1.0 annot-version=v1.0 MNDYYQCVGDYRGTARYMPPEMVNVKKVSPAMDVWALGCTVLEMLTGNRPWKGWSGKEEELEVEIGRGRHPVIPDWLCEEAKDFLGMCFENSWLRRANCW DLLRHPFAGGRLRVEAQLSEPVKIRVPEPVEEARIPNHLLLPHLMFDELNLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46140			Protein kinase superfamily pro...		Lus10031910 [exp]	0	1
AT4G12490			Bifunctional inhibitor/lipid-t...		Lus10012763 [exp]	1.0	0.7165
AT5G53110			RING/U-box superfamily protein...		Lus10019018 [exp]	36.1	0.6686
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10003660 [exp]	54.9	0.6434
					Lus10034849 [exp]	63.3	0.5889
AT4G12010			Disease resistance protein (TI...		Lus10016029 [exp]	67.7	0.6256
AT5G38940			RmlC-like cupins superfamily p...		Lus10038441 [exp]	71.5	0.5429
AT3G63410		VTE3, APG1, IEP...	VITAMIN E DEFECTIVE 3, INNER E...		Lus10003095 [exp]	100.1	0.6180
					Lus10043242 [exp]	100.5	0.6229
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10027281 [exp]	118.5	0.6136
					Lus10008418 [exp]	135.0	0.5467

Compare expression of checked genes

Lus10031910 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.