Plant FIBer expression Database

Lus10031912 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55140 160 / 1e-52 ribosomal protein L30 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004595
[exp]
213 / 1e-73 AT5G55140 161 / 6e-53 ribosomal protein L30 family protein (.1)
Lus10011966
[exp]
203 / 1e-69 AT5G55140 160 / 1e-52 ribosomal protein L30 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G225600
[exp]
179 / 4e-60 AT5G55140 154 / 4e-50 ribosomal protein L30 family protein (.1)
Potri.014G157400
[exp]
177 / 2e-59 AT5G55140 151 / 5e-49 ribosomal protein L30 family protein (.1)
Potri.010G076275
[exp]
81 / 2e-21 AT5G55140 68 / 2e-16 ribosomal protein L30 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00327 Ribosomal_L30 Ribosomal protein L30p/L7e
Representative CDS sequence
>Lus10031912 pacid=23161166 polypeptide=Lus10031912 locus=Lus10031912.g ID=Lus10031912.BGIv1.0 annot-version=v1.0
ATGAATGGTTTCAAGGCTTTCAAAGCCCAAGTCCCAATAGCTTGGAGTCCCAAGCTATACATAACCCTGGTGAGAGGGATTCCTGGAACCAGGAGACTCC
ATAGGCGCACCCTGGAGGCATTGTGTCTCACAAAGTGCAATCGGACTGTAACACGAGAGAATTGTTCATCCATTAGAGGAATGCTTCAACAGGTTAAGAG
GTTAGTCGTCATTGAGACAGAAGAGATGTACAATGCTCGCAAGCAGAACGACGCAAAGCACAAGGCCGTACGTCCTCCAGTCGTCATAGGCCACTCTCCA
GTCACTGCGAGTAGCTTTGCGTAG
AA sequence
>Lus10031912 pacid=23161166 polypeptide=Lus10031912 locus=Lus10031912.g ID=Lus10031912.BGIv1.0 annot-version=v1.0
MNGFKAFKAQVPIAWSPKLYITLVRGIPGTRRLHRRTLEALCLTKCNRTVTRENCSSIRGMLQQVKRLVVIETEEMYNARKQNDAKHKAVRPPVVIGHSP
VTASSFA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55140 ribosomal protein L30 family p... Lus10031912
[exp]
0 1
AT4G14965 ATMAPR4 membrane-associated progestero... Lus10018026
[exp]
2.4 0.8757
AT4G14965 ATMAPR4 membrane-associated progestero... Lus10042022
[exp]
2.6 0.8792
AT4G31720 STG1, TAFII15, ... TBP-ASSOCIATED FACTOR 10, SALT... Lus10005077
[exp]
3.9 0.8755
AT1G08845 Ribosomal L18p/L5e family prot... Lus10001727
[exp]
3.9 0.8729
AT1G22140 unknown protein Lus10025627
[exp]
4.0 0.8754
AT4G21192 Cytochrome c oxidase biogenesi... Lus10019246
[exp]
4.2 0.8725
AT4G19150 Ankyrin repeat family protein ... Lus10001048
[exp]
6.0 0.8517
AT3G11591 unknown protein Lus10016986
[exp]
6.3 0.8510
AT4G19150 Ankyrin repeat family protein ... Lus10001414
[exp]
9.6 0.8090
AT5G64350 FKP12, ATFKBP12... ARABIDOPSIS THALIANA FK506-BIN... Lus10003760
[exp]
10.6 0.8340

Lus10031912 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.