Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02468 70 / 2e-18 CPuORF9 conserved peptide upstream open reading frame 9 (.1) AT3G25572 66 / 1e-16 CPuORF11 conserved peptide upstream open reading frame 11 (.1) AT5G15948 64 / 4e-16 CPuORF10 conserved peptide upstream open reading frame 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035082 [exp] 77 / 4e-21 AT5G15948 72 / 3e-19 conserved peptide upstream open reading frame 10 (.1) Lus10019146 [exp] 62 / 2e-13 AT3G25570 478 / 3e-169 Adenosylmethionine decarboxylase family protein (.1.2) Lus10034412 [exp] 60 / 1e-12 AT3G25570 481 / 3e-170 Adenosylmethionine decarboxylase family protein (.1.2) Lus10000156 [exp] 60 / 2e-12 AT3G25570 486 / 3e-172 Adenosylmethionine decarboxylase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G133850 [exp] 77 / 5e-21 AT3G02468 70 / 3e-18 conserved peptide upstream open reading frame 9 (.1) Potri.004G106750 [exp] 71 / 1e-18 AT3G02468 64 / 6e-16 conserved peptide upstream open reading frame 9 (.1) Potri.017G108901 [exp] 69 / 1e-17 AT5G15948 67 / 3e-16 conserved peptide upstream open reading frame 10 (.1) Potri.018G101400 [exp] 67 / 2e-17 AT3G02468 61 / 1e-14 conserved peptide upstream open reading frame 9 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08132 [flax] [poplar] AdoMetDC_leader S-adenosyl-l-methionine decarboxylase leader peptide
Representative CDS sequence Show only first row Show all	>Lus10031918 pacid=23161327 polypeptide=Lus10031918 locus=Lus10031918.g ID=Lus10031918.BGIv1.0 annot-version=v1.0 ATGGAGTCAAAAGGTGGTAAGAAGAAGTCCAGTAGTAGTAAATCATTATTCTACGAAGCTCCCCTCGGTTACAGCATTGAAGACGTTCGCCCAAACGGTG GAATTAAGAAATTCAGATCTGCTGCATACTCCAACTGCGCTCGCAAGCCATCCTGA
AA sequence Show only first row Show all	>Lus10031918 pacid=23161327 polypeptide=Lus10031918 locus=Lus10031918.g ID=Lus10031918.BGIv1.0 annot-version=v1.0 MESKGGKKKSSSSKSLFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G15948		CPuORF10	conserved peptide upstream ope...		Lus10031918 [exp]	0	1
AT5G15948		CPuORF10	conserved peptide upstream ope...		Lus10035082 [exp]	1.0	0.9333
AT4G08330			unknown protein		Lus10018170 [exp]	4.6	0.7337
AT1G73480			alpha/beta-Hydrolases superfam...		Lus10009041 [exp]	11.7	0.7430
AT3G61600		ATPOB1	POZ/BTB containin G-protein 1 ...		Lus10032340 [exp]	13.4	0.7217
AT3G25570			Adenosylmethionine decarboxyla...		Lus10035083 [exp]	16.9	0.8310
AT5G19875			unknown protein		Lus10024507 [exp]	18.3	0.7245
AT4G30210		AR2, ATR2	P450 reductase 2 (.1.2)		Lus10025485 [exp]	24.7	0.7104
AT5G19260		FAF3	FANTASTIC FOUR 3, Protein of u...		Lus10021930 [exp]	36.1	0.6558
AT1G73730	EIL	AtEIL3, ATSLIM,...	ARABIDOPSIS THALIANA SULFUR LI...		Lus10031817 [exp]	37.6	0.7411
AT1G10380			Putative membrane lipoprotein ...		Lus10037235 [exp]	39.6	0.6171

Compare expression of checked genes

Lus10031918 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.