Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47820 74 / 3e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035088 [exp] 127 / 4e-39 AT1G47820 76 / 4e-19 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G121300 [exp] 87 / 2e-23 AT1G47820 75 / 4e-19 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031924 pacid=23161128 polypeptide=Lus10031924 locus=Lus10031924.g ID=Lus10031924.BGIv1.0 annot-version=v1.0 ATGGAGATTGATGGTAGCAACAATGGTATCCGTGTTAAGGCCACTTTTACATTCAGACTTGGCTCAGAATCCCACTCAGTAGCTGCCGGGAAAGGCGATA CAATCTCAGAGGAGCTGGTTTCAATGAAGGAAGAAAGCATGAGGATACTCAAGGAGTTCATAACCAAACATAACGTTCCTGCTGATGTTCCTGATGAGTT AATAGATGATGATGGCTCTGGTGATGAGGATGCAGAAGAGGCTGCGAAATTGCCAAAGCTTTATCTATCCACTCTGTATTTGTTATGGGTTGAAGCAATA GTCAATCATATTGAGTTCAGATCGATGTATCTATACAAGAATCTATTCATCTAA
AA sequence Show only first row Show all	>Lus10031924 pacid=23161128 polypeptide=Lus10031924 locus=Lus10031924.g ID=Lus10031924.BGIv1.0 annot-version=v1.0 MEIDGSNNGIRVKATFTFRLGSESHSVAAGKGDTISEELVSMKEESMRILKEFITKHNVPADVPDELIDDDGSGDEDAEEAAKLPKLYLSTLYLLWVEAI VNHIEFRSMYLYKNLFI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47820			unknown protein		Lus10031924 [exp]	0	1
AT5G60790		ABCF1, ATGCN1	ARABIDOPSIS THALIANA GENERAL C...		Lus10037947 [exp]	1.7	0.8572
AT2G32070			Polynucleotidyl transferase, r...		Lus10003635 [exp]	2.0	0.8738
AT5G01650			Tautomerase/MIF superfamily pr...		Lus10022681 [exp]	4.0	0.8478
AT1G58210		EMB1674	EMBRYO DEFECTIVE 1674, kinase ...		Lus10001866 [exp]	4.0	0.8594
AT1G31830			Amino acid permease family pro...		Lus10007593 [exp]	7.7	0.8290
AT3G47300		SELT	SELT-like protein precursor (....		Lus10002479 [exp]	11.5	0.8061
AT2G43770			Transducin/WD40 repeat-like su...		Lus10002211 [exp]	12.0	0.7876
AT4G02500		ATXT2, XXT2	XYG XYLOSYLTRANSFERASE 2, ARAB...		Lus10037520 [exp]	12.8	0.8424
AT4G03965			RING/U-box superfamily protein...		Lus10029993 [exp]	13.6	0.8214
AT4G17600		LIL3:1	Chlorophyll A-B binding family...		Lus10001008 [exp]	15.9	0.8049

Compare expression of checked genes

Lus10031924 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.