Lus10031925 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G37870 125 / 2e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G53980 83 / 6e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT5G05960 77 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G48130 44 / 1e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G22600 39 / 0.0004 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT5G13900 39 / 0.0004 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G03103 38 / 0.001 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004677 76 / 5e-18 AT5G05960 142 / 8e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10009872 73 / 8e-17 AT5G05960 148 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10000397 72 / 2e-16 AT5G05960 138 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10014681 44 / 2e-05 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10041196 40 / 0.0002 AT1G05450 122 / 5e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10021911 40 / 0.0002 AT1G05450 121 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G141000 137 / 6e-42 AT2G37870 121 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.010G100600 135 / 2e-41 AT2G37870 122 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.010G196300 82 / 3e-20 AT5G05960 150 / 2e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.008G061800 77 / 2e-18 AT5G05960 155 / 3e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.016G104300 74 / 3e-17 AT3G53980 143 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.013G131500 43 / 2e-05 AT5G13900 122 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.004G196000 42 / 5e-05 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.010G085400 39 / 0.0006 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.008G155100 39 / 0.0008 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Lus10031925 pacid=23161313 polypeptide=Lus10031925 locus=Lus10031925.g ID=Lus10031925.BGIv1.0 annot-version=v1.0
ATGGCGACTAGAGCTGGTCATTGGCTCGTCGCAGCCGCAGTAATCACTCTTCTCCTGCTTTCGAACGTCAACACTAACACCGTCATGACTGCTGAAGCAG
CCGGCAAGAGAGGCGGCGGAGGAGGCGGCTCTGCATGTGGCAAGACACCAATTAGCTCGGCGGCGGCTAGTCTGAGCCCCTGCTTGGGCGCCGCAAAGAG
CCCAAGGGCCCCCGTGCCGCCCGCGTGCTGCTCCAAGGTCGGAGGACTGATCAAGGCGGCTCCAAAGTGCCTTTGCGCAGTTCTGTTGTCCCCGTTGGCG
AAGCAGGCTGGAATCCAGCCTGGGATTGCGATCACCATCCCCAAACGCTGCAACATCCGCAATCGCCCCGCCGGAAAGAAGTGTGGAGTTTTTCCGGATG
AGCAGTTGAGTCAGGAGATGGAGATCATGACTGAGCGAGCAGAAGTAAGAGTGGGTTGTCAAAAGGAGAGAGGGAGGGCATGGTCAGCAGAGAGTGATCA
ATCAGAGCATGGTGTGGGAATATGA
AA sequence
>Lus10031925 pacid=23161313 polypeptide=Lus10031925 locus=Lus10031925.g ID=Lus10031925.BGIv1.0 annot-version=v1.0
MATRAGHWLVAAAVITLLLLSNVNTNTVMTAEAAGKRGGGGGGSACGKTPISSAAASLSPCLGAAKSPRAPVPPACCSKVGGLIKAAPKCLCAVLLSPLA
KQAGIQPGIAITIPKRCNIRNRPAGKKCGVFPDEQLSQEMEIMTERAEVRVGCQKERGRAWSAESDQSEHGVGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G37870 Bifunctional inhibitor/lipid-t... Lus10031925 0 1
AT3G54450 Major facilitator superfamily ... Lus10039521 1.0 0.9777
AT2G17270 PHT3;3 phosphate transporter 3;3 (.1) Lus10035975 2.4 0.9777
AT2G36450 AP2_ERF HRD HARDY, Integrase-type DNA-bind... Lus10023873 2.8 0.9677
Lus10041251 3.5 0.9742
AT2G29340 NAD-dependent epimerase/dehydr... Lus10004985 4.5 0.9672
AT2G36450 AP2_ERF HRD HARDY, Integrase-type DNA-bind... Lus10014376 7.9 0.9197
AT4G23610 Late embryogenesis abundant (L... Lus10027179 8.1 0.9591
AT1G24620 EF hand calcium-binding protei... Lus10028913 8.9 0.9523
AT3G11980 FAR2, MS2 MALE STERILITY 2, FATTY ACID R... Lus10000851 9.4 0.9520
AT4G23610 Late embryogenesis abundant (L... Lus10039662 9.8 0.9502

Lus10031925 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.