Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02010 228 / 7e-74 GAD4 glutamate decarboxylase 4 (.1) AT5G17330 226 / 3e-73 GAD1, GAD GLUTAMATE DECARBOXYLASE 1, glutamate decarboxylase (.1) AT3G17760 209 / 2e-66 GAD5 glutamate decarboxylase 5 (.1.2) AT2G02000 206 / 2e-65 GAD3 glutamate decarboxylase 3 (.1) AT1G65960 199 / 6e-63 GAD2 glutamate decarboxylase 2 (.1.2) AT3G17720 48 / 2e-07 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035096 [exp] 258 / 4e-84 AT2G02010 835 / 0.0 glutamate decarboxylase 4 (.1) Lus10034425 [exp] 237 / 1e-79 AT5G17330 610 / 0.0 GLUTAMATE DECARBOXYLASE 1, glutamate decarboxylase (.1) Lus10019136 [exp] 242 / 2e-79 AT2G02010 883 / 0.0 glutamate decarboxylase 4 (.1) Lus10028530 [exp] 204 / 1e-64 AT5G17330 855 / 0.0 GLUTAMATE DECARBOXYLASE 1, glutamate decarboxylase (.1) Lus10009116 [exp] 167 / 5e-50 AT2G02000 248 / 3e-75 glutamate decarboxylase 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G100500 [exp] 245 / 2e-80 AT2G02010 879 / 0.0 glutamate decarboxylase 4 (.1) Potri.008G141100 [exp] 243 / 6e-80 AT2G02010 853 / 0.0 glutamate decarboxylase 4 (.1) Potri.004G075200 [exp] 233 / 4e-76 AT5G17330 904 / 0.0 GLUTAMATE DECARBOXYLASE 1, glutamate decarboxylase (.1) Potri.017G144421 [exp] 231 / 3e-75 AT5G17330 880 / 0.0 GLUTAMATE DECARBOXYLASE 1, glutamate decarboxylase (.1) Potri.004G075300 [exp] 224 / 2e-72 AT5G17330 870 / 0.0 GLUTAMATE DECARBOXYLASE 1, glutamate decarboxylase (.1) Potri.012G039000 [exp] 209 / 9e-67 AT3G17760 816 / 0.0 glutamate decarboxylase 5 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0061 [flax] [poplar] PLP_aminotran PF00282 [flax] [poplar] Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain
Representative CDS sequence Show only first row Show all	>Lus10031934 pacid=23161232 polypeptide=Lus10031934 locus=Lus10031934.g ID=Lus10031934.BGIv1.0 annot-version=v1.0 ATGGTTCTCACTCAGATCACTTCCCAATCGGATGTCTCCGTCCACTCAACCTTCGCCTCCCGTTACGTTACGGAGTCACTCCCCCGTTACAAGATGCCCG ATAATTCCATCCCGAAAGAAGCCGCCTTCCAGATCATCAACGACGAGCTCATGCTCGACGGCAAGCCCAGGCTCAACCTCGCCTCTTTCGTCACCACTTG GATGGAGCCTGAGTGCGACAAGCTCATCATGGACTCCCTCAACAAGAACTACGTCGACATGGACGAGTACCCTGTCACCACCGAGCTCCAGAACCGCTGC GTCAACATCATCGCTCACCTCTTCAACGCTCCCCTCGGCGACGACGAGGCCGCCGTCGGTGGAGGCACCGTCGGACTGAGTTTGTACTAG
AA sequence Show only first row Show all	>Lus10031934 pacid=23161232 polypeptide=Lus10031934 locus=Lus10031934.g ID=Lus10031934.BGIv1.0 annot-version=v1.0 MVLTQITSQSDVSVHSTFASRYVTESLPRYKMPDNSIPKEAAFQIINDELMLDGKPRLNLASFVTTWMEPECDKLIMDSLNKNYVDMDEYPVTTELQNRC VNIIAHLFNAPLGDDEAAVGGGTVGLSLY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02010		GAD4	glutamate decarboxylase 4 (.1)		Lus10031934 [exp]	0	1
AT1G06475			unknown protein		Lus10020752 [exp]	2.0	0.8428
AT2G02010		GAD4	glutamate decarboxylase 4 (.1)		Lus10035096 [exp]	3.2	0.7740
AT4G37250			Leucine-rich repeat protein ki...		Lus10030333 [exp]	4.9	0.7887
AT3G55950		CCR3, ATCRR3	CRINKLY4 related 3 (.1)		Lus10040201 [exp]	5.5	0.7833
AT2G18910			hydroxyproline-rich glycoprote...		Lus10025469 [exp]	12.1	0.7581
AT1G58520		RXW8	lipases;hydrolases, acting on ...		Lus10004550 [exp]	13.1	0.7781
					Lus10006920 [exp]	13.5	0.7463
AT4G31080			Protein of unknown function (D...		Lus10009546 [exp]	13.9	0.7536
AT1G04990	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Lus10029988 [exp]	15.2	0.7512
AT3G55950		CCR3, ATCRR3	CRINKLY4 related 3 (.1)		Lus10028285 [exp]	21.2	0.7187

Compare expression of checked genes

Lus10031934 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.