Lus10031935 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14730 264 / 6e-90 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT5G38630 142 / 5e-42 ACYB-1 cytochrome B561-1 (.1)
AT4G25570 141 / 2e-41 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G26100 86 / 2e-20 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034427 338 / 4e-119 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10035096 306 / 5e-101 AT2G02010 835 / 0.0 glutamate decarboxylase 4 (.1)
Lus10039216 152 / 4e-46 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10038866 134 / 1e-38 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10028996 132 / 3e-38 AT4G25570 145 / 4e-43 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 134 / 6e-38 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 131 / 2e-37 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003682 117 / 5e-32 AT4G25570 131 / 1e-37 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003076 110 / 3e-30 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G102400 293 / 2e-101 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G138300 288 / 2e-99 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.015G143700 151 / 1e-45 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.012G141000 148 / 2e-44 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.017G111700 145 / 3e-43 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.004G103800 145 / 4e-43 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.008G115300 132 / 4e-38 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.010G131100 91 / 3e-22 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115200 90 / 9e-22 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10031935 pacid=23161065 polypeptide=Lus10031935 locus=Lus10031935.g ID=Lus10031935.BGIv1.0 annot-version=v1.0
ATGGAAACTTATAGGCGATCGGCCTCTCGGCTGACGATAGGAGCTCACTTGTTCGGGGTACTGGCAATCGTCCTGATGCTGATATGGCTACTCCACTTCC
GTCAAGGCATTGAGTATGACTCCGACAACCCCTCTCGCGTCTTCAATGTTCACCCGTTCCTCATGTTCTGCGGCTTCATCTTTCTTGTTGGCCAAGCTAT
GATGGCGTACAAGACAGTACCAGCAACAAGGCAAGCACAGAAAGCGATCCACATGGTACTCAACCTGACCGGACTGGCATTAGGAATCGCCGGAATAGCG
GCGGCGTTCAGGTTCCACGACATGGTTAATGCGGAGGACATGACCAGCCTCCACTCGTGGATCGGCCTATCTACGTTCTGCCTCTTCGGACTGCAGTGGC
TCTTCGGCTTCTTCGCCTTCATGTACCCCAAGGCCAACTCCGACGCCAGGGGAAGGCTGATGGCGTGGCACATCACCGGCGGCAGGGTGCTGCTTTACAT
GGCCGTATGTGCTTCCCTCACCGGGCTTATGGAGAGGTCGGTGTTACTCAATAACGTGATCCGTGGACATGGCGAGTCACGTCTCATCAACTTCATCGGA
CTTTGTATGTTGCTCTTTGGCATCTTTGTTGACCTCTCTGTTGCACTTGCTCACTATGTTTGA
AA sequence
>Lus10031935 pacid=23161065 polypeptide=Lus10031935 locus=Lus10031935.g ID=Lus10031935.BGIv1.0 annot-version=v1.0
METYRRSASRLTIGAHLFGVLAIVLMLIWLLHFRQGIEYDSDNPSRVFNVHPFLMFCGFIFLVGQAMMAYKTVPATRQAQKAIHMVLNLTGLALGIAGIA
AAFRFHDMVNAEDMTSLHSWIGLSTFCLFGLQWLFGFFAFMYPKANSDARGRLMAWHITGGRVLLYMAVCASLTGLMERSVLLNNVIRGHGESRLINFIG
LCMLLFGIFVDLSVALAHYV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14730 Cytochrome b561/ferric reducta... Lus10031935 0 1
AT3G20570 AtENODL9 early nodulin-like protein 9 (... Lus10011158 1.7 0.9786
AT5G22870 Late embryogenesis abundant (L... Lus10016161 2.0 0.9759
AT1G14730 Cytochrome b561/ferric reducta... Lus10034427 2.2 0.9576
AT3G05620 Plant invertase/pectin methyle... Lus10020677 3.5 0.9657
AT5G22870 Late embryogenesis abundant (L... Lus10021404 3.5 0.9645
AT3G20570 AtENODL9 early nodulin-like protein 9 (... Lus10043063 6.0 0.9554
AT1G79480 Carbohydrate-binding X8 domain... Lus10001764 6.2 0.9415
AT5G04890 RTM2 RESTRICTED TEV MOVEMENT 2, HSP... Lus10028874 7.9 0.9520
AT1G05610 APS2 ADP-glucose pyrophosphorylase ... Lus10042456 8.4 0.9469
AT1G14730 Cytochrome b561/ferric reducta... Lus10019135 9.4 0.9516

Lus10031935 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.