Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48480 77 / 1e-17 Cysteine proteinases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035097 [exp] 201 / 3e-67 AT3G48480 146 / 4e-43 Cysteine proteinases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G090800 [exp] 113 / 8e-32 AT3G48480 228 / 8e-74 Cysteine proteinases superfamily protein (.1) Potri.010G180300 [exp] 104 / 3e-28 AT3G48480 278 / 3e-93 Cysteine proteinases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031938 pacid=23161285 polypeptide=Lus10031938 locus=Lus10031938.g ID=Lus10031938.BGIv1.0 annot-version=v1.0 ATGAAGCTAGATAGTCCTCAATTCGATTCCTATTTCAAGGGCCACTGGATCCTCCTAATCCTCTGTAACCTTGATGAAAGCATGGAGTCCGAGACTGCAG TAAGACCATGCATGCTATTGCTTGATTCACTTGAGGATGCTGGTCCAAGCCGTATTGAACCAGATATAAGGAAGTTTCTGTTTGACATTTACAGATCGGA GGGCAGAGCTGAAACTAAACAGTCAATTCGTAGGATTCCTTTGTTAGTACCAAAGTCTGGATACGCCTCGTTACTGCAGATGACTCGAGACTGGTTCACG CCTCAATGCTTGGAGCATTTCTTTGAGGAATTGGATCCCCTTGAGAAAGCTTGA
AA sequence Show only first row Show all	>Lus10031938 pacid=23161285 polypeptide=Lus10031938 locus=Lus10031938.g ID=Lus10031938.BGIv1.0 annot-version=v1.0 MKLDSPQFDSYFKGHWILLILCNLDESMESETAVRPCMLLLDSLEDAGPSRIEPDIRKFLFDIYRSEGRAETKQSIRRIPLLVPKSGYASLLQMTRDWFT PQCLEHFFEELDPLEKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48480			Cysteine proteinases superfami...		Lus10031938 [exp]	0	1
AT5G08020		ATRPA70B	ARABIDOPSIS THALIANA RPA70-KDA...		Lus10036312 [exp]	13.6	0.5810
AT2G42940	AT-hook		Predicted AT-hook DNA-binding ...		Lus10007340 [exp]	17.1	0.5841
AT5G28237			Pyridoxal-5'-phosphate-depende...		Lus10008278 [exp]	26.3	0.5606
AT3G01490			Protein kinase superfamily pro...		Lus10030621 [exp]	78.7	0.5020
AT2G27610			Tetratricopeptide repeat (TPR)...		Lus10020588 [exp]	92.3	0.4717
AT2G34050			unknown protein		Lus10007055 [exp]	93.7	0.4517
AT3G48100		ATRR2, IBC6, AR...	INDUCED BY CYTOKININ 6, ARABID...		Lus10042153 [exp]	93.9	0.4661
AT2G26975			Ctr copper transporter family ...		Lus10023045 [exp]	95.0	0.4827
AT2G18980			Peroxidase superfamily protein...		Lus10001622 [exp]	112.5	0.4763
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10033613 [exp]	131.0	0.4778

Compare expression of checked genes

Lus10031938 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.