Lus10031963 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G50310 87 / 1e-21 MKKK20, MAPKKK20 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
AT3G06030 88 / 2e-21 AtANP3, MAPKKK12, ANP3 NPK1-related protein kinase 3 (.1)
AT5G67080 86 / 7e-21 MAPKKK19 mitogen-activated protein kinase kinase kinase 19 (.1)
AT1G54960 86 / 2e-20 MAPKKK2, ANP2 MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASES 2, NPK1-related protein kinase 2 (.1)
AT3G46140 84 / 2e-20 Protein kinase superfamily protein (.1)
AT1G09000 83 / 1e-19 MAPKKK1, ANP1 MAP KINASE KINASE KINASE 1, NPK1-related protein kinase 1 (.1)
AT5G55090 81 / 3e-19 MAPKKK15 mitogen-activated protein kinase kinase kinase 15 (.1)
AT4G36950 79 / 2e-18 MAPKKK21 mitogen-activated protein kinase kinase kinase 21 (.1)
AT1G07150 79 / 2e-18 MAPKKK13 mitogen-activated protein kinase kinase kinase 13 (.1.2)
AT2G42550 76 / 3e-17 Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011778 141 / 1e-43 AT3G50310 96 / 2e-23 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10026894 130 / 3e-38 AT3G50310 187 / 1e-57 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10029047 125 / 6e-38 AT3G50310 93 / 5e-23 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10029019 123 / 3e-37 AT3G50310 96 / 3e-24 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10029023 124 / 8e-37 AT3G50310 147 / 8e-43 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034285 124 / 9e-36 AT5G27510 183 / 6e-56 Protein kinase superfamily protein (.1)
Lus10034288 123 / 1e-35 AT3G50310 181 / 5e-55 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034242 122 / 2e-35 AT3G50310 190 / 2e-58 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10039141 110 / 2e-30 AT3G46140 168 / 1e-49 Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G139300 92 / 2e-23 AT5G67080 329 / 6e-112 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.005G033400 87 / 6e-21 AT1G09000 680 / 0.0 MAP KINASE KINASE KINASE 1, NPK1-related protein kinase 1 (.1)
Potri.007G044800 84 / 2e-20 AT5G67080 350 / 6e-120 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.013G022700 85 / 3e-20 AT1G09000 713 / 0.0 MAP KINASE KINASE KINASE 1, NPK1-related protein kinase 1 (.1)
Potri.008G149500 84 / 4e-20 AT3G06030 681 / 0.0 NPK1-related protein kinase 3 (.1)
Potri.005G139200 82 / 2e-19 AT5G67080 305 / 2e-102 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.010G092000 82 / 2e-19 AT3G06030 698 / 0.0 NPK1-related protein kinase 3 (.1)
Potri.001G278600 81 / 6e-19 AT1G07150 353 / 2e-117 mitogen-activated protein kinase kinase kinase 13 (.1.2)
Potri.009G131100 79 / 1e-18 AT3G50310 200 / 4e-62 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Potri.014G155000 79 / 1e-18 AT1G05100 317 / 3e-107 mitogen-activated protein kinase kinase kinase 18 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10031963 pacid=23161275 polypeptide=Lus10031963 locus=Lus10031963.g ID=Lus10031963.BGIv1.0 annot-version=v1.0
ATGAAGACTCCGGAGGTCAGTACGATCACTAGTAGTAGGAATGCTAGAGGGACGTTGATGTACATGGCACCGGAGGTGCTTCTCTCCGGGAAGGTTTCTC
CGGCGATGGATATATGGAGTTTCAGATGTAGCGTGATTGGAATGCTGGCGGGGGAGTTGCCCTGGAGCCAATGCAAAGTTGATTCAGAAGTGATTATGCA
GATATGTAAAGGGTGTCAGCCTGAGATTCCAGAGTGGCTTTGTGAACAAGGTAAGGGTTTCCTCAACAAGTGCTTTGTTAGGGATCCAAACCGCCGCCTC
CCTGCTCCAATGCTTCTCCAACATCCCTTCTTAAACAAGAAGAAATAA
AA sequence
>Lus10031963 pacid=23161275 polypeptide=Lus10031963 locus=Lus10031963.g ID=Lus10031963.BGIv1.0 annot-version=v1.0
MKTPEVSTITSSRNARGTLMYMAPEVLLSGKVSPAMDIWSFRCSVIGMLAGELPWSQCKVDSEVIMQICKGCQPEIPEWLCEQGKGFLNKCFVRDPNRRL
PAPMLLQHPFLNKKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G06030 AtANP3, MAPKKK1... NPK1-related protein kinase 3 ... Lus10031963 0 1
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10017170 8.2 0.6773
Lus10019981 16.6 0.6508
AT4G27730 ATOPT6 ARABIDOPSIS THALIANA OLIGOPEPT... Lus10007770 17.7 0.6138
AT5G04020 calmodulin binding (.1) Lus10031023 18.2 0.5836
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10037323 21.4 0.6203
AT2G36540 Haloacid dehalogenase-like hyd... Lus10019760 21.9 0.6402
AT4G21440 MYB ATMYB102, ATM4 A. THALIANA MYB 4, MYB-like 10... Lus10039772 23.7 0.6090
AT4G15390 HXXXD-type acyl-transferase fa... Lus10017702 24.2 0.6322
Lus10010466 34.0 0.5561
AT4G26590 ATOPT5 ARABIDOPSIS THALIANA OLIGOPEPT... Lus10032586 38.3 0.6203

Lus10031963 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.