Lus10031970 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G09990 259 / 3e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
AT5G18380 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
AT3G04230 243 / 3e-84 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035133 303 / 2e-107 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10034378 291 / 8e-103 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
Lus10038012 290 / 1e-102 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10009252 290 / 1e-102 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10012599 289 / 5e-102 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G304700 274 / 3e-96 AT2G09990 267 / 9e-94 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.008G150000 272 / 2e-95 AT2G09990 262 / 1e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.010G091000 271 / 4e-95 AT2G09990 260 / 7e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0329 S5 PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Representative CDS sequence
>Lus10031970 pacid=23161056 polypeptide=Lus10031970 locus=Lus10031970.g ID=Lus10031970.BGIv1.0 annot-version=v1.0
ATGGCGGCAACTGCTGCGCCTTCCCCAGTCGAGTCCGTCCAATGCTTCGGCCGTAAGAAGACGGCGGTCGCCGTCACCCACTGCAAGCGCGGTAGGGGAC
TCATCAAGCTCAACGGAACTCCGATCGAGCTCATCGAGCCTGAGATACTCCGCTTCAAGGCCGTCGAGCCCATCCTCCTCCTCGGACGTCAGCGTTTCAG
CGGTGTCGACATGCGCATCCGCGTGAAGGGAGGTGGTCACACTTCTCAGATCTACGCCATCCGTCAGAGCATCGCCAAGGCCCTTGTAGCTTTCTACCAG
AAGTTTGTGGATGAGCAGAGCAAGAAGGAAATCAAGGACCTGTTGATTAGGTATGACAGGACTTTGCTGGTTGCTGATCCCAGGCGCTGCGAGCCGAAGA
AGTTTGGTGGTCGTGGTGCCCGCTCCAGATTCCAGAAGAGTTACCGTTGA
AA sequence
>Lus10031970 pacid=23161056 polypeptide=Lus10031970 locus=Lus10031970.g ID=Lus10031970.BGIv1.0 annot-version=v1.0
MAATAAPSPVESVQCFGRKKTAVAVTHCKRGRGLIKLNGTPIELIEPEILRFKAVEPILLLGRQRFSGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQ
KFVDEQSKKEIKDLLIRYDRTLLVADPRRCEPKKFGGRGARSRFQKSYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G09990 Ribosomal protein S5 domain 2-... Lus10031970 0 1
AT3G16080 Zinc-binding ribosomal protein... Lus10035878 3.3 0.8919
AT5G60670 Ribosomal protein L11 family p... Lus10019935 3.5 0.8914
AT5G27700 Ribosomal protein S21e (.1) Lus10020645 6.3 0.8614
AT5G60670 Ribosomal protein L11 family p... Lus10026506 9.5 0.8611
AT5G48760 Ribosomal protein L13 family p... Lus10016679 10.1 0.8807
AT4G23620 Ribosomal protein L25/Gln-tRNA... Lus10011005 10.4 0.8668
AT2G28000 Cpn60alpha1, SL... SCHLEPPERLESS, chaperonin-60al... Lus10037386 10.8 0.8551
AT5G60670 Ribosomal protein L11 family p... Lus10037402 11.1 0.8795
AT3G11250 Ribosomal protein L10 family p... Lus10014841 15.7 0.8719
AT3G56150 ATTIF3C1, ATEIF... eukaryotic translation initiat... Lus10039984 16.2 0.8423

Lus10031970 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.