Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61110 145 / 2e-47 ARS27A ribosomal protein S27 (.1) AT2G45710 139 / 1e-44 Zinc-binding ribosomal protein family protein (.1) AT5G47930 138 / 2e-44 Zinc-binding ribosomal protein family protein (.1) AT3G61111 122 / 5e-38 Zinc-binding ribosomal protein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035122 [exp] 149 / 1e-48 AT3G61110 176 / 2e-59 ribosomal protein S27 (.1) Lus10031974 [exp] 149 / 1e-48 AT3G61110 176 / 2e-59 ribosomal protein S27 (.1) Lus10032212 [exp] 148 / 2e-48 AT3G61110 173 / 2e-58 ribosomal protein S27 (.1) Lus10024576 [exp] 149 / 3e-48 AT3G61110 174 / 1e-57 ribosomal protein S27 (.1) Lus10035128 [exp] 0 / 1 AT3G61110 84 / 1e-32 ribosomal protein S27 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G069100 [exp] 145 / 3e-47 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1) Potri.003G161200 [exp] 145 / 3e-47 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1) Potri.006G192900 [exp] 145 / 3e-47 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF01667 [flax] [poplar] Ribosomal_S27e Ribosomal protein S27
Representative CDS sequence Show only first row Show all	>Lus10031979 pacid=23161145 polypeptide=Lus10031979 locus=Lus10031979.g ID=Lus10031979.BGIv1.0 annot-version=v1.0 ATGGTGCTTCAAAATGATGTTGATTTGCTGAACCCACCGGCCGAGCTTGAGAAGAGAAAACACAAGCTCAAGCGTCTCGTCCAGTCCCCCAATTCCTTCT TCATGGATGTCAAGTGCCAGGGCTGCTTCAACATTACCACTGTGTTCAGCCACTCCCAAACTGTTGTTGTTTGTGGAAACTGTCAATCAGTGCTGTGCCA GCCTACCGGAGGACGTGCCAGACTCACTGAGGGATGCTCTTTCAGGAAGAAGGGTGACTAG
AA sequence Show only first row Show all	>Lus10031979 pacid=23161145 polypeptide=Lus10031979 locus=Lus10031979.g ID=Lus10031979.BGIv1.0 annot-version=v1.0 MVLQNDVDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQSVLCQPTGGRARLTEGCSFRKKGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10031979 [exp]	0	1
AT1G26880			Ribosomal protein L34e superfa...		Lus10037177 [exp]	1.4	0.9678
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Lus10008873 [exp]	1.7	0.9726
AT1G13690		ATE1	ATPase E1 (.1)		Lus10004641 [exp]	3.5	0.9472
AT4G29410			Ribosomal L28e protein family ...		Lus10032699 [exp]	3.5	0.9627
AT4G18100			Ribosomal protein L32e (.1)		Lus10009591 [exp]	5.7	0.9601
AT5G46160			Ribosomal protein L14p/L23e fa...		Lus10038513 [exp]	6.9	0.9268
AT1G09810		ECT11	evolutionarily conserved C-ter...		Lus10037365 [exp]	7.3	0.9322
AT2G47640			Small nuclear ribonucleoprotei...		Lus10026556 [exp]	7.3	0.9249
AT5G12110			Glutathione S-transferase, C-t...		Lus10036101 [exp]	8.1	0.9410
AT5G59850			Ribosomal protein S8 family pr...		Lus10029461 [exp]	8.4	0.9362

Compare expression of checked genes

Lus10031979 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.