Lus10031996 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14030 216 / 8e-72 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035166 282 / 5e-98 AT5G14030 264 / 7e-91 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10012565 254 / 5e-87 AT5G14030 254 / 5e-87 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10041525 240 / 1e-79 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G323400 228 / 7e-77 AT5G14030 215 / 2e-71 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Potri.017G061900 228 / 3e-76 AT5G14030 210 / 6e-69 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0159 E-set PF05753 TRAP_beta Translocon-associated protein beta (TRAPB)
Representative CDS sequence
>Lus10031996 pacid=23161125 polypeptide=Lus10031996 locus=Lus10031996.g ID=Lus10031996.BGIv1.0 annot-version=v1.0
ATGGCGATCCCAGTGCTTAGCTCTCTAGTTTCTGTGCTGCTCATTCTGCTCTTCGTCTCCTCGACGACCTTAGCTGCCACTGATGTCCCTTTCATCGTAG
CTCACAAGAAGGCCACTCTCAACAGGCTCAAATCCGGCGCTGAACGCGTCTCTGTCTCCATCGATATCTACAACCAAGGATCCTCGACAGCTTATGATGT
GAGTCTTGTCGATGATCACTGGCCTCAAGATTTATTTGATGTTCTGAGCGGTAACGTTTCACAATCATGGGAACGTCTGGATTCTGGTGGTTTGTTGTCA
CATTCTTTTGAACTCGAGGGAAAAGTGAAGGGCGTGTTCTACAGTGCCCCAGCTGTTATTACATTCCGCATCCCTACCAAGGCTGTTTTACAGGAGGCAT
TCTCAACTCCAATTATGCCCCTCGATATTCTGGCCGACAGACCTACTGAGAATAAGCTTGATTTGAGGTTGTTGGCGAAGTATGGATCTTTGGTATCGGT
CATTTCAATCGTGGTTCTGTTTGTGTACCTTGTGAGCACTCCGTCCAAATCTAGTGGTCCGAAAGGGAGCAAGAAGAAGCGTTAA
AA sequence
>Lus10031996 pacid=23161125 polypeptide=Lus10031996 locus=Lus10031996.g ID=Lus10031996.BGIv1.0 annot-version=v1.0
MAIPVLSSLVSVLLILLFVSSTTLAATDVPFIVAHKKATLNRLKSGAERVSVSIDIYNQGSSTAYDVSLVDDHWPQDLFDVLSGNVSQSWERLDSGGLLS
HSFELEGKVKGVFYSAPAVITFRIPTKAVLQEAFSTPIMPLDILADRPTENKLDLRLLAKYGSLVSVISIVVLFVYLVSTPSKSSGPKGSKKKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14030 translocon-associated protein ... Lus10031996 0 1
AT2G04780 FLA7 FASCICLIN-like arabinoogalacta... Lus10012351 9.3 0.7156
AT2G44050 COS1 coronatine insensitive1 suppre... Lus10018133 27.8 0.6383
AT5G14230 unknown protein Lus10022339 68.4 0.6307
AT1G15550 ATGA3OX1, GA4 GA REQUIRING 4, ARABIDOPSIS TH... Lus10023113 94.0 0.6199
AT1G42480 unknown protein Lus10030732 98.3 0.5806
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10023337 103.7 0.6278
AT3G63120 CYCP1;1 cyclin p1;1 (.1) Lus10022038 119.4 0.6003
AT2G37470 Histone superfamily protein (.... Lus10006484 131.6 0.5849
AT1G64520 RPN12A regulatory particle non-ATPase... Lus10023053 199.5 0.5773
AT5G14230 unknown protein Lus10041588 260.6 0.5725

Lus10031996 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.