Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14000 112 / 3e-30 NAC ANAC084 NAC domain containing protein 84 (.1) AT5G13180 110 / 4e-29 NAC VNDIP2, ANAC083, VNI2 VND-interacting 2, NAC domain containing protein 83 (.1) AT2G33480 108 / 4e-28 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT5G53950 102 / 4e-25 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G39610 100 / 7e-25 NAC ORE1, AtNAC2, ANAC092, ATNAC6 ORESARA 1, NAC domain containing protein 2, Arabidopsis NAC domain containing protein 92, NAC domain containing protein 6 (.1) AT3G04060 99 / 6e-24 NAC ANAC046 NAC domain containing protein 46 (.1) AT5G07680 98 / 7e-24 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT5G61430 97 / 2e-23 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT1G61110 95 / 1e-22 NAC ANAC025 NAC domain containing protein 25 (.1) AT3G15510 94 / 3e-22 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035174 [exp] 405 / 1e-144 AT5G14000 115 / 2e-31 NAC domain containing protein 84 (.1) Lus10041534 [exp] 212 / 1e-68 AT2G33480 125 / 1e-34 NAC domain containing protein 41 (.1.2) Lus10012557 [exp] 205 / 1e-65 AT5G14000 122 / 4e-34 NAC domain containing protein 84 (.1) Lus10002581 [exp] 119 / 2e-32 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10001809 [exp] 118 / 4e-32 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10030446 [exp] 100 / 9e-25 AT1G69490 302 / 2e-103 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10026617 [exp] 99 / 3e-24 AT1G69490 298 / 1e-101 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10006547 [exp] 98 / 1e-23 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2) Lus10037156 [exp] 97 / 1e-23 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G325100 [exp] 159 / 8e-48 AT5G13180 163 / 2e-49 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.017G063300 [exp] 155 / 2e-46 AT5G13180 150 / 9e-45 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.015G102100 [exp] 120 / 7e-33 AT5G13180 232 / 8e-77 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.003G166500 [exp] 119 / 3e-32 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.001G061200 [exp] 117 / 1e-31 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.012G103500 [exp] 115 / 7e-31 AT5G13180 229 / 2e-75 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.012G001400 [exp] 100 / 3e-24 AT5G61430 448 / 1e-158 NAC domain containing protein 100 (.1) Potri.006G129400 [exp] 98 / 1e-23 AT1G61110 247 / 3e-80 NAC domain containing protein 25 (.1) Potri.019G031600 [exp] 97 / 4e-23 AT5G18270 328 / 6e-111 Arabidopsis NAC domain containing protein 87 (.1.2) Potri.019G031400 [exp] 97 / 4e-23 AT3G04070 332 / 1e-112 NAC domain containing protein 47 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10032004 pacid=23161156 polypeptide=Lus10032004 locus=Lus10032004.g ID=Lus10032004.BGIv1.0 annot-version=v1.0 ATGGAGAAACAGAGCATGAATGGAGGTGGAGGAATCAAGCTCCCTATTGGGTACAGATTCCGACCAACAGACGAGGAGCTCATCGTCCATTACCTCAGAC GTAAGGTGTTCGGTCTACCTTTGCCCGCTTCTGTCATCCCTGACCTCAATGATCCCTCCACTGCACTGCCATCAGGCAACCCAAGTGAGAAAAGGTACTT CTTTTGCAAAGGAGATGATCATAACAGAAGTAATAAGATTGTGGAGGAGAAAGGAGGTTACTGGAAGCATACTGGGAAAGCCAGGCATATTTTTGCAGCG TCTTCTTCCAACAACCAATTAGTCGGGATTAGGAGAAGTCTGGTTTTCCAGACACATAACGGCAAAAGAAACAAGAACCAAACTCATAAGTGGGTCATGC ATGAGTTCTGCCTTGTGGGTTTCGTCACTATCCCCTTTACAAATCAGATATCAATGGTGAAGGTGGGAGAGTGGGTTTTGTGCAGTGTGCTCCAGAAGAA GAGAAGGGCTAGTACTAATGCTAACAAGAAGAAGCTCATCTCAAGATGTTCTACTTCACCAAATCCAGTTAGAGATCAAGATTCCATGGATTTTAGAGTG GATGAGTTGTCTGATGCAGGGCCTAGTTGTGATGATCATGAAGAGGAGGAAGAAGAAGAAGGAAAGGTGGGATCTTTGAGTGGAATCACAGAACTTTCTT CTACAAAATCTTCATCATCAAGTGGGTTATTATTAGTTGAAGAAGAAGATATTACTGTTCATCCAATGTTAGCTTGA
AA sequence Show only first row Show all	>Lus10032004 pacid=23161156 polypeptide=Lus10032004 locus=Lus10032004.g ID=Lus10032004.BGIv1.0 annot-version=v1.0 MEKQSMNGGGGIKLPIGYRFRPTDEELIVHYLRRKVFGLPLPASVIPDLNDPSTALPSGNPSEKRYFFCKGDDHNRSNKIVEEKGGYWKHTGKARHIFAA SSSNNQLVGIRRSLVFQTHNGKRNKNQTHKWVMHEFCLVGFVTIPFTNQISMVKVGEWVLCSVLQKKRRASTNANKKKLISRCSTSPNPVRDQDSMDFRV DELSDAGPSCDDHEEEEEEEGKVGSLSGITELSSTKSSSSSGLLLVEEEDITVHPMLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14000	NAC	ANAC084	NAC domain containing protein ...		Lus10032004 [exp]	0	1
AT3G04690		ANX1	ANXUR1, Malectin/receptor-like...		Lus10016907 [exp]	2.2	0.7451
AT4G00950		MEE47	maternal effect embryo arrest ...		Lus10030238 [exp]	4.2	0.7192
AT2G41510		ATCKX1, CKX1	cytokinin oxidase/dehydrogenas...		Lus10019762 [exp]	6.5	0.7148
AT2G37470			Histone superfamily protein (....		Lus10006484 [exp]	11.5	0.6843
AT1G80230			Rubredoxin-like superfamily pr...		Lus10035917 [exp]	14.5	0.6956
AT5G46860		SGR3, ATVAM3, A...	SHOOT GRAVITROPISM 3, ARABIDOP...		Lus10040094 [exp]	21.9	0.6863
AT5G46240		KAT1	potassium channel in Arabidops...		Lus10028128 [exp]	23.0	0.6670
AT5G50600		ATHSD1	hydroxysteroid dehydrogenase 1...		Lus10043187 [exp]	24.8	0.6950
AT5G39210		CRR7	chlororespiratory reduction 7 ...		Lus10032982 [exp]	25.0	0.7064
AT1G16860			Ubiquitin-specific protease fa...		Lus10005996 [exp]	25.7	0.6340

Compare expression of checked genes

Lus10032004 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.