Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042979 [exp] 52 / 1e-08 AT5G08020 54 / 5e-07 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1) Lus10006918 [exp] 51 / 2e-08 ND / Lus10039504 [exp] 47 / 8e-08 ND / Lus10027118 [exp] 47 / 2e-07 ND / Lus10023767 [exp] 45 / 2e-06 ND / Lus10021668 [exp] 44 / 4e-06 ND / Lus10003025 [exp] 44 / 7e-06 AT5G61000 57 / 2e-08 Replication factor-A protein 1-related (.1) Lus10023006 [exp] 44 / 9e-06 ND / Lus10039353 [exp] 44 / 1e-05 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032008 pacid=23161245 polypeptide=Lus10032008 locus=Lus10032008.g ID=Lus10032008.BGIv1.0 annot-version=v1.0 ATGAACATGTTTGATCTTTCCGCCAATGATCCGTCGCCGGAACTCCTTTTACGGGTCCACCATGTTTGGCGGCTCGGGGACCCCTCCCGTCCAGCCGACT GCTTTGCTGTTGGGACACTGTGGGCTGCTGTGGAGGTGAGCTTCGTGAATCCGCCCACCACTGCTCCTTTTCCTATCCTTCCAGCCATCGTCTATGGATT CGCTAACCGCTGTTTGTTGTTTGCTTTCATTTCAGGGTTTGCGCATGCGGGATGGACTCTATGGTGGATGGAATATGATTTTCTAGTTGGGTCTATCAAC ATAGCATACTGGGTGATTGCAGAACTGCAATTTACGACACTGATTGGAGTCTAA
AA sequence Show only first row Show all	>Lus10032008 pacid=23161245 polypeptide=Lus10032008 locus=Lus10032008.g ID=Lus10032008.BGIv1.0 annot-version=v1.0 MNMFDLSANDPSPELLLRVHHVWRLGDPSRPADCFAVGTLWAAVEVSFVNPPTTAPFPILPAIVYGFANRCLLFAFISGFAHAGWTLWWMEYDFLVGSIN IAYWVIAELQFTTLIGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032008 [exp]	0	1
AT2G21710		EMB2219	embryo defective 2219, Mitocho...		Lus10042322 [exp]	2.0	0.8945
AT3G06500		A/N-InvC	alkaline/neutral invertase C, ...		Lus10037817 [exp]	3.2	0.8702
AT5G53170		FTSH11	FTSH protease 11 (.1)		Lus10014930 [exp]	5.3	0.8739
AT5G36930			Disease resistance protein (TI...		Lus10010574 [exp]	6.0	0.7890
AT5G24490			30S ribosomal protein, putativ...		Lus10015569 [exp]	6.5	0.8743
AT3G07310			Protein of unknown function (D...		Lus10038208 [exp]	7.0	0.8521
AT4G31040			CemA-like proton extrusion pro...		Lus10040575 [exp]	7.7	0.8563
AT5G24490			30S ribosomal protein, putativ...		Lus10032935 [exp]	7.9	0.8762
AT1G55140			Ribonuclease III family protei...		Lus10015626 [exp]	8.2	0.8164
AT5G62650			Tic22-like family protein (.1)		Lus10027537 [exp]	10.7	0.7882

Compare expression of checked genes

Lus10032008 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.