Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41050 162 / 2e-51 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G26960 156 / 4e-49 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G13140 142 / 3e-42 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 44 / 7e-06 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT5G45880 43 / 3e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G29140 39 / 0.0004 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 38 / 0.001 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035187 [exp] 327 / 2e-116 AT5G41050 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10012553 [exp] 219 / 2e-74 AT5G41050 168 / 3e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041541 [exp] 214 / 2e-72 AT5G41050 169 / 2e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10034365 [exp] 51 / 6e-08 AT5G15780 129 / 7e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10005086 [exp] 47 / 2e-06 AT5G15780 133 / 5e-35 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 43 / 2e-05 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 43 / 3e-05 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 41 / 9e-05 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 41 / 9e-05 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G068400 [exp] 206 / 5e-69 AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G326200 [exp] 205 / 3e-68 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 193 / 4e-62 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 165 / 4e-51 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G100600 [exp] 57 / 5e-10 AT5G15780 173 / 1e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 53 / 2e-08 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 42 / 6e-05 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 40 / 0.0002 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10032018 pacid=23161091 polypeptide=Lus10032018 locus=Lus10032018.g ID=Lus10032018.BGIv1.0 annot-version=v1.0 ATGAATCATCATCCCATTACTTTTGTTTTGTTCCTCATCTCATGTTTACTTGCCAAATCACTCTCCTTCCCCGCAAGAACTGCCCAAATCAGAGTAATTG GTTTTGTCTACTGTGACATCTGCTCCAATAACAGCTTTTCCAGCCACAGCTATTTCATGCCAGGTTCAGAAGTAGAGATAGACTGCAAGTTCAGAGCAAA TGCCCCCAAAACAACAGAGGATATTGCATTCTCAGTGAACAGAACAACAAACAGGTACGGTGTCTACAAATTCGACATACCAGCTGTCGACGGGATCGAA TGTGCAGAAGAGTCGGCCGCCATTGCCACGTCCTGCGAGGCGAGCTTGATCGGGACTTCGTCGAGATCGTGCAATGTTCCCGGATACAAATTCACATCGG AGCAGATAGCAGTTATCAAGGCAAGGAAACCCAATCTCTGCATCTACAGCCTCAATGCCTTGACTTTCAGACCCTCCAAACACGATGTCTCTTTGTGCGG CCATTAG
AA sequence Show only first row Show all	>Lus10032018 pacid=23161091 polypeptide=Lus10032018 locus=Lus10032018.g ID=Lus10032018.BGIv1.0 annot-version=v1.0 MNHHPITFVLFLISCLLAKSLSFPARTAQIRVIGFVYCDICSNNSFSSHSYFMPGSEVEIDCKFRANAPKTTEDIAFSVNRTTNRYGVYKFDIPAVDGIE CAEESAAIATSCEASLIGTSSRSCNVPGYKFTSEQIAVIKARKPNLCIYSLNALTFRPSKHDVSLCGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10032018 [exp]	0	1
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10035187 [exp]	1.0	0.9528
AT2G25737			Sulfite exporter TauE/SafE fam...		Lus10011683 [exp]	2.8	0.8920
AT5G43270	SBP	SPL2	squamosa promoter binding prot...		Lus10021614 [exp]	3.2	0.9061
AT2G47240		CER8, LACS1	LONG-CHAIN ACYL-COA SYNTHASE 1...		Lus10002414 [exp]	4.2	0.9016
AT5G56850			unknown protein		Lus10032679 [exp]	4.9	0.8968
AT1G09310			Protein of unknown function, D...		Lus10010904 [exp]	9.2	0.8963
AT3G06880			Transducin/WD40 repeat-like su...		Lus10036201 [exp]	10.5	0.8466
AT3G15030	TCP	TCP4, MEE35	maternal effect embryo arrest ...		Lus10000463 [exp]	13.7	0.8408
AT3G11720			Polyketide cyclase/dehydrase a...		Lus10016185 [exp]	14.3	0.8559
AT5G54010			UDP-Glycosyltransferase superf...		Lus10013337 [exp]	16.4	0.8851

Compare expression of checked genes

Lus10032018 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.