Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035197 [exp] 237 / 2e-82 ND / Lus10008547 [exp] 148 / 2e-45 ND / Lus10034546 [exp] 124 / 1e-37 AT3G22060 43 / 1e-05 Receptor-like protein kinase-related family protein (.1) Lus10013255 [exp] 116 / 2e-34 ND / Lus10034545 [exp] 115 / 4e-34 ND / Lus10013256 [exp] 116 / 1e-33 AT3G21970 39 / 8e-04 Domain of unknown function (DUF26) (.1) Lus10030780 [exp] 114 / 1e-33 ND 36 / 0.004 Lus10013254 [exp] 111 / 2e-32 ND / Lus10030777 [exp] 108 / 3e-31 AT5G48540 39 / 8e-04 receptor-like protein kinase-related family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032027 pacid=23161162 polypeptide=Lus10032027 locus=Lus10032027.g ID=Lus10032027.BGIv1.0 annot-version=v1.0 ATGGCAATAATGCTGCTTATATTAACATCATCGGGTACAGTGTTGGGGCAAAATTCTTGCGGCTCGAGAAAGCCGGCAGCAGTCGGGGTATGTAAAGACG ACTACGCGAGTTGTGTAGCTAACGTGATCACGGTGTTAAGGGACAGGACGGCCTACACTAAAAATCAGAGGTTCGATACGGCTTACCCACTTAACGGACC ATCTGGCGGCGTTGTGGGTCAAGCGGCTTGTGTCGACGGATCTAGCTTTGCAGAGTGCCAGAGAAGCCTCTCCGCCGCTAAAAAATGGCTCGAGCAGAAT TGCGGCGGTTCTTCTGCCGGCGGCACCTTCTCCGACAGGATTTGCTCCATGGCGTACGGCCAACTGTCGCGTTAA
AA sequence Show only first row Show all	>Lus10032027 pacid=23161162 polypeptide=Lus10032027 locus=Lus10032027.g ID=Lus10032027.BGIv1.0 annot-version=v1.0 MAIMLLILTSSGTVLGQNSCGSRKPAAVGVCKDDYASCVANVITVLRDRTAYTKNQRFDTAYPLNGPSGGVVGQAACVDGSSFAECQRSLSAAKKWLEQN CGGSSAGGTFSDRICSMAYGQLSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032027 [exp]	0	1
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Lus10041381 [exp]	21.9	0.5336
AT1G76750			Protein of unknown function (D...		Lus10004598 [exp]	23.0	0.5418
AT2G32460	MYB	ATMYB101, AtM1	ARABIDOPSIS THALIANA MYB 1, my...		Lus10027189 [exp]	25.9	0.5271
AT1G29450			SAUR-like auxin-responsive pro...		Lus10007057 [exp]	58.9	0.4547
AT5G40400			Pentatricopeptide repeat (PPR)...		Lus10022182 [exp]	148.3	0.4209

Compare expression of checked genes

Lus10032027 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.