Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27030 106 / 2e-31 unknown protein AT5G40970 101 / 2e-30 Protein of unknown function (DUF 3339) (.1) AT3G48660 92 / 2e-26 Protein of unknown function (DUF 3339) (.1) AT5G08391 88 / 5e-25 Protein of unknown function (DUF 3339) (.1) AT5G63500 87 / 9e-25 Protein of unknown function (DUF 3339) (.1) AT3G27027 83 / 7e-23 Protein of unknown function (DUF 3339) (.1) AT3G01950 81 / 3e-22 Protein of unknown function (DUF 3339) (.1) AT5G14110 80 / 8e-22 Protein of unknown function (DUF 3339) (.1) AT5G40980 72 / 1e-18 Protein of unknown function (DUF 3339) (.1) AT3G01940 55 / 6e-12 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035199 [exp] 136 / 5e-44 AT3G27030 108 / 4e-32 unknown protein Lus10032029 [exp] 137 / 1e-43 AT3G27027 106 / 4e-30 Protein of unknown function (DUF 3339) (.1) Lus10041551 [exp] 119 / 3e-37 AT3G27030 113 / 3e-34 unknown protein Lus10012542 [exp] 119 / 3e-37 AT3G27030 113 / 3e-34 unknown protein Lus10037035 [exp] 90 / 9e-26 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 90 / 1e-25 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 89 / 2e-25 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 89 / 4e-25 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 87 / 9e-25 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G064500 [exp] 120 / 8e-38 AT3G27030 111 / 2e-33 unknown protein Potri.001G328800 [exp] 115 / 4e-36 AT3G27030 79 / 2e-20 unknown protein Potri.015G098200 [exp] 100 / 2e-29 AT3G27030 107 / 7e-31 unknown protein Potri.003G170500 [exp] 95 / 1e-27 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170400 [exp] 93 / 7e-27 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 93 / 7e-27 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 91 / 2e-26 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 89 / 2e-25 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 86 / 6e-24 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.001G328701 [exp] 82 / 8e-22 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10032030 pacid=23161319 polypeptide=Lus10032030 locus=Lus10032030.g ID=Lus10032030.BGIv1.0 annot-version=v1.0 ATGACTGACTGGGGTCCAATCTTGATAGGGGTAGTCTTGTTCATCCTGCTCACGCCAGGACTCTTGTTTCAGTTCCCAGGGCACAGCAGACAGATCGAGT TTGGAAGCTTGAAGACCAACGGGAAATCCATCGCGGTTCACACTCTCATATTCTTCACTGTCTATGCCATTCTCATCTTGGCTGTTCGTGTCCACGTCTA CACTGGCTAG
AA sequence Show only first row Show all	>Lus10032030 pacid=23161319 polypeptide=Lus10032030 locus=Lus10032030.g ID=Lus10032030.BGIv1.0 annot-version=v1.0 MTDWGPILIGVVLFILLTPGLLFQFPGHSRQIEFGSLKTNGKSIAVHTLIFFTVYAILILAVRVHVYTG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27030			unknown protein		Lus10032030 [exp]	0	1
AT1G52420			UDP-Glycosyltransferase superf...		Lus10011469 [exp]	3.5	0.8122
AT1G75140			unknown protein		Lus10007163 [exp]	4.7	0.8176
AT4G00650		FLA, FRI	FLOWERING LOCUS A, FRIGIDA-lik...		Lus10016738 [exp]	7.7	0.7852
AT5G15450		AtCLPB3, APG6, ...	CASEIN LYTIC PROTEINASE B-P, A...		Lus10013191 [exp]	9.9	0.8153
AT5G19180		ECR1	E1 C-terminal related 1 (.1)		Lus10034043 [exp]	10.5	0.8110
					Lus10011573 [exp]	11.0	0.8107
AT3G12120		FAD2	fatty acid desaturase 2 (.1.2)		Lus10004175 [exp]	13.0	0.8039
AT5G28040	GeBP		DNA-binding storekeeper protei...		Lus10019007 [exp]	14.5	0.7803
AT4G35870			early-responsive to dehydratio...		Lus10041862 [exp]	15.4	0.8118
AT4G23930			Late embryogenesis abundant (L...		Lus10032397 [exp]	17.4	0.7643

Compare expression of checked genes

Lus10032030 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.