Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08391 104 / 1e-31 Protein of unknown function (DUF 3339) (.1) AT3G27030 102 / 8e-30 unknown protein AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1) AT5G63500 95 / 9e-28 Protein of unknown function (DUF 3339) (.1) AT3G27027 83 / 4e-23 Protein of unknown function (DUF 3339) (.1) AT5G14110 79 / 2e-21 Protein of unknown function (DUF 3339) (.1) AT3G01950 77 / 8e-21 Protein of unknown function (DUF 3339) (.1) AT5G40980 76 / 2e-20 Protein of unknown function (DUF 3339) (.1) AT5G40970 69 / 2e-17 Protein of unknown function (DUF 3339) (.1) AT5G50660 60 / 9e-14 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035201 [exp] 140 / 1e-45 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 104 / 2e-31 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 104 / 2e-31 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 102 / 2e-30 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 100 / 5e-30 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10035198 [exp] 94 / 2e-27 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1) Lus10032028 [exp] 94 / 2e-27 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 94 / 4e-27 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 92 / 1e-26 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G064301 [exp] 116 / 3e-36 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 116 / 3e-36 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 106 / 3e-32 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 105 / 6e-32 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170400 [exp] 97 / 1e-28 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 92 / 3e-26 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.017G064500 [exp] 86 / 4e-24 AT3G27030 111 / 2e-33 unknown protein Potri.001G058001 [exp] 83 / 9e-23 AT3G48660 74 / 9e-19 Protein of unknown function (DUF 3339) (.1) Potri.001G328800 [exp] 82 / 9e-23 AT3G27030 79 / 2e-20 unknown protein Potri.001G328701 [exp] 84 / 1e-22 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10032032 pacid=23161146 polypeptide=Lus10032032 locus=Lus10032032.g ID=Lus10032032.BGIv1.0 annot-version=v1.0 ATGATGGTGGATTGGGGGCCAGTGTTTATTGCAGTGATGCTGTTCATACTGCTAACACCAGGGCTGCTCATCCAGGTACCTGGAAACGGGCGGTACGTCG AGTTCAGCAACTTCCAGACGAGTGGAGTTTCGGTTCTGGTTCATTCCATCATTTACTTCTCTTTGATGTGCATCTTCTTGCTTGCTATTGGTCTCCATAT GTATGTGGGTGCATAA
AA sequence Show only first row Show all	>Lus10032032 pacid=23161146 polypeptide=Lus10032032 locus=Lus10032032.g ID=Lus10032032.BGIv1.0 annot-version=v1.0 MMVDWGPVFIAVMLFILLTPGLLIQVPGNGRYVEFSNFQTSGVSVLVHSIIYFSLMCIFLLAIGLHMYVGA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08391			Protein of unknown function (D...		Lus10032032 [exp]	0	1
AT5G46530			AWPM-19-like family protein (....		Lus10025374 [exp]	2.0	0.9052
AT5G59030		COPT1	copper transporter 1 (.1)		Lus10017204 [exp]	6.6	0.8889
AT4G05220			Late embryogenesis abundant (L...		Lus10006755 [exp]	8.8	0.8864
AT1G62760			Plant invertase/pectin methyle...		Lus10004327 [exp]	9.8	0.8593
AT2G15310		ATARFB1A	ADP-ribosylation factor B1A (....		Lus10002817 [exp]	13.2	0.8689
AT2G37925		COPT4	copper transporter 4 (.1)		Lus10021108 [exp]	14.5	0.8754
AT5G22870			Late embryogenesis abundant (L...		Lus10041350 [exp]	15.2	0.8768
AT5G22870			Late embryogenesis abundant (L...		Lus10016161 [exp]	16.6	0.8822
AT4G21310			Protein of unknown function (D...		Lus10018386 [exp]	21.2	0.8412
AT3G17730	NAC	ANAC057	NAC domain containing protein ...		Lus10042284 [exp]	21.5	0.8617

Compare expression of checked genes

Lus10032032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.