Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27970 228 / 1e-78 NTF2B nuclear transport factor 2B (.1.2) AT1G27310 218 / 6e-75 NTF2A nuclear transport factor 2A (.1) AT1G11570 151 / 2e-48 NTL NTF2-like (.1.2) AT5G60980 55 / 1e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT5G48650 54 / 2e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT1G13730 52 / 7e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT3G25150 45 / 2e-06 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037033 [exp] 241 / 4e-84 AT1G27970 231 / 5e-80 nuclear transport factor 2B (.1.2) Lus10035202 [exp] 206 / 4e-70 AT1G27310 184 / 1e-61 nuclear transport factor 2A (.1) Lus10015772 [exp] 192 / 3e-64 AT1G27310 188 / 9e-63 nuclear transport factor 2A (.1) Lus10020061 [exp] 153 / 4e-49 AT1G11570 171 / 3e-56 NTF2-like (.1.2) Lus10006762 [exp] 114 / 7e-34 AT1G11570 130 / 2e-40 NTF2-like (.1.2) Lus10036918 [exp] 57 / 2e-10 AT2G03640 250 / 4e-78 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10025906 [exp] 56 / 4e-10 AT3G25150 363 / 4e-118 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10037066 [exp] 56 / 9e-10 AT2G03640 248 / 2e-77 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10004644 [exp] 54 / 3e-09 AT2G03640 253 / 2e-79 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G057500 [exp] 229 / 1e-79 AT1G27970 228 / 4e-79 nuclear transport factor 2B (.1.2) Potri.003G170800 [exp] 226 / 3e-78 AT1G27970 230 / 1e-79 nuclear transport factor 2B (.1.2) Potri.011G025500 [exp] 157 / 1e-50 AT1G11570 171 / 5e-56 NTF2-like (.1.2) Potri.010G157800 [exp] 55 / 9e-10 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) Potri.008G096700 [exp] 54 / 1e-09 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Potri.017G094600 [exp] 54 / 3e-09 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.002G246600 [exp] 53 / 5e-09 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.015G058700 [exp] 49 / 1e-07 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.010G065500 [exp] 40 / 0.0002 AT5G43960 310 / 3e-101 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.002G257000 [exp] 38 / 0.001 AT5G43960 402 / 3e-137 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0051 [flax] [poplar] NTF2 PF02136 [flax] [poplar] NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence Show only first row Show all	>Lus10032033 pacid=23161064 polypeptide=Lus10032033 locus=Lus10032033.g ID=Lus10032033.BGIv1.0 annot-version=v1.0 ATGAATCCAGATGCTGTGGCCAAGGCTTTCGTCGATCACTACTACTCCACCTTCGACAGTAACCGAGCGGGACTCATCGGATTGTATCAAGACGGATCCA TGTTGACGTTCGAAGGCCAGCAGATCCAGGGCGCTCAGAACATCGTTGGCAAGCTCACCAGCCTTCCTTTCGAGCAGTGCAAGCACTCCGTCACCACCGT CGATTGCCAGCCGTCGGGTCCCGCCGGTGGCATGCTCGTGTTTGTTAGCGGTAATCTTCAATTGGCCGGCGAGCAACACCCTCTCAAGTTCAGTCAGATG TTCCATTTGATGCCGACTCCTCAAGGAAGTTTCTACGTGTTCAACGATATCTTCCGCTTGAACTACGCATGA
AA sequence Show only first row Show all	>Lus10032033 pacid=23161064 polypeptide=Lus10032033 locus=Lus10032033.g ID=Lus10032033.BGIv1.0 annot-version=v1.0 MNPDAVAKAFVDHYYSTFDSNRAGLIGLYQDGSMLTFEGQQIQGAQNIVGKLTSLPFEQCKHSVTTVDCQPSGPAGGMLVFVSGNLQLAGEQHPLKFSQM FHLMPTPQGSFYVFNDIFRLNYA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27970		NTF2B	nuclear transport factor 2B (....		Lus10032033 [exp]	0	1
AT2G33410			RNA-binding (RRM/RBD/RNP motif...		Lus10043124 [exp]	2.2	0.8950
AT5G19180		ECR1	E1 C-terminal related 1 (.1)		Lus10034043 [exp]	2.8	0.8793
AT1G27310		NTF2A	nuclear transport factor 2A (....		Lus10035202 [exp]	2.8	0.8903
AT4G28230			unknown protein		Lus10033724 [exp]	4.0	0.8693
AT1G55890			Tetratricopeptide repeat (TPR)...		Lus10020073 [exp]	4.2	0.8857
AT4G26500		SUFE1, EMB1374,...	SULFUR E 1, MBRYO DEFECTIVE 13...		Lus10032905 [exp]	4.2	0.8687
AT2G02590			unknown protein		Lus10013278 [exp]	6.3	0.8664
AT5G01650			Tautomerase/MIF superfamily pr...		Lus10014233 [exp]	6.3	0.8444
AT1G77405			Pentatricopeptide repeat (PPR)...		Lus10042736 [exp]	7.4	0.8646
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Lus10027839 [exp]	7.9	0.8710

Compare expression of checked genes

Lus10032033 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.