Lus10032038 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G24318 155 / 3e-45 O-Glycosyl hydrolases family 17 protein (.1.2)
AT3G55430 146 / 5e-42 O-Glycosyl hydrolases family 17 protein (.1)
AT2G39640 141 / 1e-39 glycosyl hydrolase family 17 protein (.1)
AT3G46570 129 / 3e-36 Glycosyl hydrolase superfamily protein (.1)
AT5G42720 127 / 6e-35 Glycosyl hydrolase family 17 protein (.1)
AT2G16230 121 / 2e-32 O-Glycosyl hydrolases family 17 protein (.1)
AT1G32860 118 / 1e-31 Glycosyl hydrolase superfamily protein (.1)
AT1G30080 116 / 7e-31 Glycosyl hydrolase superfamily protein (.1)
AT4G34480 116 / 2e-30 O-Glycosyl hydrolases family 17 protein (.1)
AT4G18340 113 / 6e-30 Glycosyl hydrolase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021088 280 / 6e-95 AT5G24318 324 / 3e-108 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10004962 196 / 8e-61 AT5G24318 462 / 8e-161 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10040808 196 / 4e-60 AT5G24318 484 / 2e-168 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10016539 193 / 2e-59 AT5G24318 484 / 1e-168 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10005166 162 / 2e-47 AT5G24318 385 / 1e-129 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10040294 137 / 3e-38 AT3G55430 483 / 2e-169 O-Glycosyl hydrolases family 17 protein (.1)
Lus10023245 136 / 6e-38 AT5G24318 561 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10004869 127 / 5e-35 AT2G27500 491 / 5e-174 Glycosyl hydrolase superfamily protein (.1.2.3)
Lus10020618 127 / 6e-35 AT2G27500 494 / 5e-175 Glycosyl hydrolase superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G240000 176 / 6e-53 AT5G24318 508 / 2e-178 O-Glycosyl hydrolases family 17 protein (.1.2)
Potri.012G017800 150 / 2e-43 AT5G24318 583 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Potri.008G056000 149 / 4e-43 AT3G55430 494 / 1e-173 O-Glycosyl hydrolases family 17 protein (.1)
Potri.008G055900 141 / 7e-40 AT3G55430 494 / 8e-174 O-Glycosyl hydrolases family 17 protein (.1)
Potri.010G203800 140 / 1e-39 AT3G55430 354 / 2e-118 O-Glycosyl hydrolases family 17 protein (.1)
Potri.014G183000 135 / 5e-39 AT5G42720 331 / 4e-112 Glycosyl hydrolase family 17 protein (.1)
Potri.014G182500 134 / 2e-37 AT2G16230 504 / 4e-177 O-Glycosyl hydrolases family 17 protein (.1)
Potri.014G184900 134 / 2e-37 AT2G16230 498 / 2e-174 O-Glycosyl hydrolases family 17 protein (.1)
Potri.014G182000 134 / 4e-37 AT2G16230 506 / 2e-177 O-Glycosyl hydrolases family 17 protein (.1)
Potri.014G182321 134 / 4e-37 AT2G16230 506 / 4e-177 O-Glycosyl hydrolases family 17 protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence
>Lus10032038 pacid=23161055 polypeptide=Lus10032038 locus=Lus10032038.g ID=Lus10032038.BGIv1.0 annot-version=v1.0
ATGGCGAAAATCTCCACCTTCCTCCTCTGCCTCTGCCTTACGATCACCCAATCCCCCGCCCACTCCATCGGAGTAAACTACGGCACCAACGCCGACAACC
TCCCACCCCACGCCAAAGTAGCCACCTTTCTAAAATCCCACACTATCATCGACCGAGTCAAAATCAACGACACCAATCCAGACATCCTCCGCGGATTCGC
CAACACAGGGATCTCCGTCGCCGTCGCAATTCCCAGAGAAGAAATCCCATCCCTCGCCAATCTCCCCGCCGCCAAATCATGGGTCGCCAAGCACATCACC
CCATTCTACCCCAAAACCAAATTCAACTACATCCTCGTCGGAAACGAGGTCTTCTTCTGGAACGAAACTAACGTCATCAGGAAACTCGTCCCTGCAATGA
AGGCCCTGACCAAGGCACTGGAGCTGGCGAATCTAGCGGCCCACATCAAGGTCTCCTCCCTTCATGGGCTTCAATTCATCGAGCCCACCCAGCCGCCAAG
CTCGGCCCAGTTTCAGAACTACGCGAGCCCTGTTCTCCGCAAGGCGTTGGAATTCCACCTCCGTACGGGACTCCGTTCCTGGTGA
AA sequence
>Lus10032038 pacid=23161055 polypeptide=Lus10032038 locus=Lus10032038.g ID=Lus10032038.BGIv1.0 annot-version=v1.0
MAKISTFLLCLCLTITQSPAHSIGVNYGTNADNLPPHAKVATFLKSHTIIDRVKINDTNPDILRGFANTGISVAVAIPREEIPSLANLPAAKSWVAKHIT
PFYPKTKFNYILVGNEVFFWNETNVIRKLVPAMKALTKALELANLAAHIKVSSLHGLQFIEPTQPPSSAQFQNYASPVLRKALEFHLRTGLRSW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G24318 O-Glycosyl hydrolases family 1... Lus10032038 0 1
Lus10037775 1.0 0.9199
AT3G46570 Glycosyl hydrolase superfamily... Lus10032039 2.0 0.8799
AT4G39950 CYP79B2 "cytochrome P450, family 79, s... Lus10031151 5.5 0.8882
AT2G03350 Protein of unknown function, D... Lus10037126 9.7 0.8892
AT5G35370 S-locus lectin protein kinase ... Lus10028067 13.2 0.8042
AT2G20520 FLA6 FASCICLIN-like arabinogalactan... Lus10033651 17.2 0.8770
AT3G20300 Protein of unknown function (D... Lus10009722 20.4 0.8686
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10004348 20.8 0.8765
AT3G26040 HXXXD-type acyl-transferase fa... Lus10012759 22.4 0.8363
AT3G63520 ATNCED1, ATCCD1... carotenoid cleavage dioxygenas... Lus10009513 22.8 0.8378

Lus10032038 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.