Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46570 147 / 2e-44 Glycosyl hydrolase superfamily protein (.1) AT5G24318 129 / 1e-36 O-Glycosyl hydrolases family 17 protein (.1.2) AT5G42720 128 / 2e-36 Glycosyl hydrolase family 17 protein (.1) AT2G16230 118 / 2e-32 O-Glycosyl hydrolases family 17 protein (.1) AT4G34480 112 / 4e-30 O-Glycosyl hydrolases family 17 protein (.1) AT3G55430 100 / 3e-26 O-Glycosyl hydrolases family 17 protein (.1) AT2G26600 96 / 6e-25 Glycosyl hydrolase superfamily protein (.1.2) AT3G15800 96 / 1e-24 Glycosyl hydrolase superfamily protein (.1) AT2G39640 96 / 4e-24 glycosyl hydrolase family 17 protein (.1) AT5G55180 94 / 1e-23 O-Glycosyl hydrolases family 17 protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021088 [exp] 206 / 2e-67 AT5G24318 324 / 3e-108 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10005459 [exp] 165 / 2e-51 AT5G24318 341 / 3e-115 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10016539 [exp] 168 / 4e-51 AT5G24318 484 / 1e-168 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10040808 [exp] 168 / 6e-51 AT5G24318 484 / 2e-168 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10004962 [exp] 166 / 2e-50 AT5G24318 462 / 8e-161 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10023245 [exp] 136 / 3e-39 AT5G24318 561 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10040294 [exp] 128 / 3e-36 AT3G55430 483 / 2e-169 O-Glycosyl hydrolases family 17 protein (.1) Lus10008865 [exp] 126 / 2e-35 AT5G24318 517 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10040461 [exp] 119 / 1e-32 AT2G16230 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G240000 [exp] 158 / 3e-47 AT5G24318 508 / 2e-178 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.015G010100 [exp] 137 / 3e-40 AT5G24318 466 / 1e-163 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.012G017800 [exp] 137 / 1e-39 AT5G24318 583 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.008G056000 [exp] 137 / 1e-39 AT3G55430 494 / 1e-173 O-Glycosyl hydrolases family 17 protein (.1) Potri.008G055900 [exp] 124 / 8e-35 AT3G55430 494 / 8e-174 O-Glycosyl hydrolases family 17 protein (.1) Potri.010G203800 [exp] 124 / 1e-34 AT3G55430 354 / 2e-118 O-Glycosyl hydrolases family 17 protein (.1) Potri.004G153800 [exp] 120 / 2e-33 AT4G34480 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G184100 [exp] 113 / 2e-31 AT2G16230 362 / 1e-122 O-Glycosyl hydrolases family 17 protein (.1) Potri.009G115400 [exp] 114 / 3e-31 AT4G34480 645 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G182500 [exp] 114 / 4e-31 AT2G16230 504 / 4e-177 O-Glycosyl hydrolases family 17 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00332 [flax] [poplar] Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence Show only first row Show all	>Lus10032039 pacid=23161117 polypeptide=Lus10032039 locus=Lus10032039.g ID=Lus10032039.BGIv1.0 annot-version=v1.0 ATGCTGGACGAGATGCTGGATGCGGTTTATGTTTCGATGAAGAAACTGGACGGGAGATTTAAGGATGTGGAGATTGTGATTGGGGAGACGGGGTGGCCGA CGGTGGGTGAACCGACCCAGCCAGGTACCGGGCTGGAAAATGCCCGTGAGTACAACCGAAACGTTGTGAGGCACGTGAGATCCGGAAAGGGGACTCCGTT AATGCCGAATCGGACTTTCGAGACTTACATCTTCTCCCTGTTTGACGAGAACCTCGAGATTTATGCTTCCGACCGGAGTTTCGGTGTTTTCAAGCCGGAT TTCTCCGCCGTTTACGACGCCGGGCTCATCCGTAGCAAGCCGATATAA
AA sequence Show only first row Show all	>Lus10032039 pacid=23161117 polypeptide=Lus10032039 locus=Lus10032039.g ID=Lus10032039.BGIv1.0 annot-version=v1.0 MLDEMLDAVYVSMKKLDGRFKDVEIVIGETGWPTVGEPTQPGTGLENAREYNRNVVRHVRSGKGTPLMPNRTFETYIFSLFDENLEIYASDRSFGVFKPD FSAVYDAGLIRSKPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46570			Glycosyl hydrolase superfamily...		Lus10032039 [exp]	0	1
AT5G24318			O-Glycosyl hydrolases family 1...		Lus10032038 [exp]	2.0	0.8799
AT2G40220	AP2_ERF	ATABI4, GIN6, S...	SUCROSE UNCOUPLED 6, SUGAR-INS...		Lus10040944 [exp]	2.6	0.8333
AT5G35370			S-locus lectin protein kinase ...		Lus10028067 [exp]	3.3	0.8161
AT4G11290			Peroxidase superfamily protein...		Lus10028688 [exp]	4.9	0.8563
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10012759 [exp]	6.9	0.8510
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10031151 [exp]	13.6	0.8469
AT5G47950			HXXXD-type acyl-transferase fa...		Lus10002893 [exp]	14.9	0.8513
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10008611 [exp]	23.9	0.8367
AT5G13960		SDG33, KYP, SUV...	SET DOMAIN PROTEIN 33, KRYPTON...		Lus10001798 [exp]	27.0	0.7880
AT1G14950			Polyketide cyclase/dehydrase a...		Lus10033397 [exp]	27.2	0.7960

Compare expression of checked genes

Lus10032039 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.