Lus10032045 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27080 201 / 4e-65 TOM20-3 translocase of outer membrane 20 kDa subunit 3 (.1)
AT1G27390 194 / 1e-62 TOM20-2 translocase outer membrane 20-2 (.1)
AT5G40930 176 / 1e-55 TOM20-4 translocase of outer membrane 20-4 (.1)
AT3G27070 169 / 5e-53 TOM20-1 translocase outer membrane 20-1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035211 427 / 4e-154 AT3G27080 210 / 1e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10012532 273 / 7e-87 AT3G01910 616 / 0.0 sulfite oxidase (.1.2.3)
Lus10011363 144 / 1e-42 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10006419 142 / 4e-42 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10041558 110 / 3e-30 AT3G27080 83 / 5e-20 translocase of outer membrane 20 kDa subunit 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G330200 242 / 3e-81 AT1G27390 215 / 3e-71 translocase outer membrane 20-2 (.1)
Potri.001G054900 223 / 6e-74 AT1G27390 230 / 4e-77 translocase outer membrane 20-2 (.1)
Potri.003G173400 211 / 2e-69 AT3G27080 208 / 2e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF06552 TOM20_plant Plant specific mitochondrial import receptor subunit TOM20
Representative CDS sequence
>Lus10032045 pacid=23161195 polypeptide=Lus10032045 locus=Lus10032045.g ID=Lus10032045.BGIv1.0 annot-version=v1.0
ATGGACATGTCGAGCGATTTGGACAGGATGCTCTTCTTCGAGCACGCTCGTAAAACAGCTGAGGCTACCTATGCTACCAACCCGCTGGATGCCGAGTTCT
GGGGTTATTCATTTGTTACTGCGGTGTCTAGCTTTCTAGTGCTTGAATTTGAACTTTATGGTGATTTCCGGGGTCAGAACTTGACGAGATGGGGTGGATC
TCTGATGGAGCTGGCTCAGTTTCAGAGTGTTCCAGATGCGAAGAAGATGATTCTAGATGGAATTTCCAAGTTAGATGAGGCATTGTCGATAAATCCCATG
AAGCATGATGCTCTCTGGTGTCTGGGAAATGCTAATACATCTTATGCATTCTTAACCCCCAGCGAGGAGGAAGCAGATGCATATTTCAAAAAAGCAACTG
TCTACTTTCAACAAGCTGTTGTTGAGGATCCAAGCAATGAGTTGTATGCCAAGTCTCTAGAAGTGGCTGCTAAGGCACCAGAATTGCACTCAGAGATTCA
TAAGCGTGGTATGTTGGACCAACAAGCATTAGGTGGTGGACCGGCACCTGGACCTTCTGCCCCAATGGCCAAAAAGACCGCAAAGAAGGAGAAGATCAGC
GATTCCACGTACGACGCATTAGGATGGGTTATTCTTGCGGTAGGGATTTTTGCAATGTTGGGACTCGCAAAATCCCAGATGCCTCCAGTTCCCCCACCTG
CCCGGTAA
AA sequence
>Lus10032045 pacid=23161195 polypeptide=Lus10032045 locus=Lus10032045.g ID=Lus10032045.BGIv1.0 annot-version=v1.0
MDMSSDLDRMLFFEHARKTAEATYATNPLDAEFWGYSFVTAVSSFLVLEFELYGDFRGQNLTRWGGSLMELAQFQSVPDAKKMILDGISKLDEALSINPM
KHDALWCLGNANTSYAFLTPSEEEADAYFKKATVYFQQAVVEDPSNELYAKSLEVAAKAPELHSEIHKRGMLDQQALGGGPAPGPSAPMAKKTAKKEKIS
DSTYDALGWVILAVGIFAMLGLAKSQMPPVPPPAR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G27080 TOM20-3 translocase of outer membrane ... Lus10032045 0 1
AT3G27080 TOM20-3 translocase of outer membrane ... Lus10035211 6.1 0.9353
AT4G29830 VIP3 vernalization independence 3, ... Lus10017159 8.2 0.9305
AT3G15000 cobalt ion binding (.1) Lus10043130 9.2 0.9226
AT5G43970 ATTOM22-V, TOM2... TRANSLOCASE OUTER MITOCHONDRIA... Lus10024950 10.9 0.9164
AT3G49910 Translation protein SH3-like f... Lus10018139 12.5 0.9304
AT5G02820 BIN5, RHL2 ROOT HAIRLESS 2, BRASSINOSTERO... Lus10003996 14.7 0.9106
AT3G49660 AtWDR5a human WDR5 \(WD40 repeat\) hom... Lus10003487 16.5 0.9011
AT3G11400 ATEIF3G1, EIF3G... eukaryotic translation initiat... Lus10012833 18.3 0.9198
AT5G13780 Acyl-CoA N-acyltransferases (N... Lus10016378 25.1 0.9122
AT4G39880 Ribosomal protein L23/L15e fam... Lus10041700 26.6 0.9178

Lus10032045 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.