Lus10032050 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40900 107 / 3e-28 Nucleotide-diphospho-sugar transferase family protein (.1)
AT4G19970 95 / 1e-22 unknown protein
AT1G14590 88 / 2e-20 Nucleotide-diphospho-sugar transferase family protein (.1)
AT2G02061 86 / 7e-20 Nucleotide-diphospho-sugar transferase family protein (.1)
AT5G44820 78 / 5e-17 Nucleotide-diphospho-sugar transferase family protein (.1)
AT1G28695 67 / 4e-13 Nucleotide-diphospho-sugar transferase family protein (.1)
AT1G28710 65 / 2e-12 Nucleotide-diphospho-sugar transferase family protein (.1.2.3)
AT4G15970 65 / 2e-12 Nucleotide-diphospho-sugar transferase family protein (.1)
AT1G28700 63 / 7e-12 Nucleotide-diphospho-sugar transferase family protein (.1)
AT1G70630 42 / 0.0002 Nucleotide-diphospho-sugar transferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031927 100 / 1e-25 AT1G14590 386 / 7e-135 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10019139 98 / 2e-24 AT1G14590 406 / 8e-142 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10031330 97 / 9e-24 AT2G02061 359 / 4e-122 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10034422 97 / 9e-24 AT1G14590 411 / 2e-143 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10031903 95 / 6e-23 AT2G02061 361 / 1e-122 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10017981 85 / 2e-19 AT1G14590 303 / 9e-101 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10041976 84 / 5e-19 AT1G14590 292 / 4e-96 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10041977 84 / 7e-19 AT1G14590 296 / 9e-98 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10041973 82 / 2e-18 AT1G14590 302 / 3e-100 Nucleotide-diphospho-sugar transferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G142200 99 / 2e-24 AT1G14590 454 / 2e-160 Nucleotide-diphospho-sugar transferase family protein (.1)
Potri.010G099400 97 / 1e-23 AT1G14590 490 / 1e-173 Nucleotide-diphospho-sugar transferase family protein (.1)
Potri.015G029200 94 / 1e-22 AT1G14590 405 / 8e-141 Nucleotide-diphospho-sugar transferase family protein (.1)
Potri.012G037300 89 / 7e-21 AT1G14590 404 / 1e-140 Nucleotide-diphospho-sugar transferase family protein (.1)
Potri.015G110600 88 / 1e-20 AT1G28710 300 / 2e-101 Nucleotide-diphospho-sugar transferase family protein (.1.2.3)
Potri.012G112600 84 / 2e-19 AT1G28710 306 / 6e-104 Nucleotide-diphospho-sugar transferase family protein (.1.2.3)
Potri.014G051600 68 / 2e-13 AT1G28710 344 / 5e-117 Nucleotide-diphospho-sugar transferase family protein (.1.2.3)
Potri.002G139800 67 / 4e-13 AT1G28710 337 / 1e-114 Nucleotide-diphospho-sugar transferase family protein (.1.2.3)
Potri.002G166000 41 / 0.0004 AT4G01220 524 / 0.0 male gametophyte defective 4, Nucleotide-diphospho-sugar transferase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0110 GT-A PF03407 Nucleotid_trans Nucleotide-diphospho-sugar transferase
Representative CDS sequence
>Lus10032050 pacid=23161311 polypeptide=Lus10032050 locus=Lus10032050.g ID=Lus10032050.BGIv1.0 annot-version=v1.0
ATGGAAACTAGAACGGTGATCGTAACGGTGATTGAAGATAATTCGAGGGCTGGTTCTGATATTATTCATGGATCTCCGTCGACGGTGGAGAATTTCCTGG
ATATGTTGAGAGATGGAGAGACAACCAAACACCTTGTGAATCACTTGGTAGTTTTGACGTTGGATCCTCGAAGTTTTCGTCATTGCAAATCGGTCCATCC
CCACTGCTTCTTCTTGGAGTACCGTGGTAGAAGGGAACTGTACAAAGCCACCTTAAAGAGGAGGAATGAGTTTCTAGTCCAAGTGCTTGAATTGGGTTAC
AACTTGTTTTTTACGGATGTGGGTTTACTATGGTGGAAGAACCCACTCCCGATGTTTGGTGGTGAAGACCACATATCGATAGGATGCGAGTTTTGGAAAC
AAAGAAGAGAGTACTTCTACCTAAAGTCTGGTGCCAGATCCATTCACTTGTTCAAGCTGTGGAAGCTGTTTAGCTTTATCCACCCTCAAACCCAGAACTC
CTCTTTATGTGAACTCAGATACAACGAAGAACTCGGTTCGGTTATCAACAAAACCACCATCTTCATCCCTAGCCAGACAGCCAGTTCAATGTAG
AA sequence
>Lus10032050 pacid=23161311 polypeptide=Lus10032050 locus=Lus10032050.g ID=Lus10032050.BGIv1.0 annot-version=v1.0
METRTVIVTVIEDNSRAGSDIIHGSPSTVENFLDMLRDGETTKHLVNHLVVLTLDPRSFRHCKSVHPHCFFLEYRGRRELYKATLKRRNEFLVQVLELGY
NLFFTDVGLLWWKNPLPMFGGEDHISIGCEFWKQRREYFYLKSGARSIHLFKLWKLFSFIHPQTQNSSLCELRYNEELGSVINKTTIFIPSQTASSM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40900 Nucleotide-diphospho-sugar tra... Lus10032050 0 1
AT2G37370 unknown protein Lus10009063 1.0 0.9682
AT2G37370 unknown protein Lus10025285 4.5 0.8970
AT2G22620 Rhamnogalacturonate lyase fami... Lus10004281 5.8 0.9265
Lus10030256 6.6 0.8454
AT2G29940 ABCG31, PDR3, A... ATP-binding cassette G31, plei... Lus10040676 7.7 0.9145
AT4G20040 Pectin lyase-like superfamily ... Lus10008700 8.9 0.8793
Lus10003753 9.5 0.8793
Lus10027520 9.6 0.8066
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000682 10.0 0.8793
AT3G52970 CYP76G1 "cytochrome P450, family 76, s... Lus10032339 10.5 0.8793

Lus10032050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.