Lus10032055 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53970 39 / 4e-05 proteasome inhibitor-related (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035223 57 / 2e-11 AT3G53970 276 / 4e-92 proteasome inhibitor-related (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G103800 46 / 1e-07 AT3G53970 206 / 2e-65 proteasome inhibitor-related (.1.2)
PFAM info
Representative CDS sequence
>Lus10032055 pacid=23161061 polypeptide=Lus10032055 locus=Lus10032055.g ID=Lus10032055.BGIv1.0 annot-version=v1.0
ATGGCGACAGAGAAGTCAGTGATCGCCGTGATTCGAGGAGCAAGACCTTCGTTTAAGAACAATCACGACAAGGCTGCTTTCGCCGTTCACGCTTCCTTCC
TCGCCGCCGGTTACATGCTCACTGCCACCGGGCCTGCCGCCGTGCCGGCGGGCGCTCCCCCCTCCACCTCCGCTGGCGCCTAA
AA sequence
>Lus10032055 pacid=23161061 polypeptide=Lus10032055 locus=Lus10032055.g ID=Lus10032055.BGIv1.0 annot-version=v1.0
MATEKSVIAVIRGARPSFKNNHDKAAFAVHASFLAAGYMLTATGPAAVPAGAPPSTSAGA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G53970 proteasome inhibitor-related (... Lus10032055 0 1
AT1G10170 ATNFXL1 NF-X-like 1 (.1) Lus10025071 10.8 0.6667
AT5G18550 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10002880 11.7 0.6846
AT2G31890 ATRAP RAP (.1) Lus10006143 12.0 0.6323
AT4G31080 Protein of unknown function (D... Lus10009547 23.4 0.6758
AT4G34100 RING/U-box superfamily protein... Lus10019839 31.3 0.6393
AT2G42490 Copper amine oxidase family pr... Lus10019485 33.4 0.6149
AT5G18550 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10033962 35.1 0.6399
AT1G72740 MYB Homeodomain-like/winged-helix ... Lus10040111 52.5 0.5745
Lus10007762 71.8 0.5747
AT4G01660 ATABC1, ATATH10... ABC transporter 1 (.1) Lus10007202 85.5 0.5390

Lus10032055 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.