Lus10032069 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G04970 195 / 6e-58 ATGSL01, ATGSL1 GLUCAN SYNTHASE LIKE-1, GLUCAN SYNTHASE LIKE 1, glucan synthase-like 1 (.1)
AT4G03550 188 / 2e-55 ATGSL5, PMR4, GSL5, ATGSL05 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1)
AT1G05570 114 / 2e-29 ATGSL6, ATGSL06, GSL6, CALS1 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2)
AT5G13000 113 / 4e-29 CALS3, ATGSL12 callose synthase 3, glucan synthase-like 12 (.1.2)
AT2G31960 112 / 9e-29 ATGSL3, ATGSL03 glucan synthase-like 3 (.1.2)
AT5G36870 110 / 4e-28 ATGSL9, ATGSL09 glucan synthase-like 9 (.1)
AT2G13680 105 / 3e-26 GLS2, ATGSL02, CALS5 ARABIDOPSIS THALIANA GLUCAN SYNTHASE-LIKE 2, callose synthase 5 (.1)
AT3G14570 96 / 3e-23 ATGSL4, ATGSL04 glucan synthase-like 4 (.1.2)
AT3G59100 92 / 1e-21 ATGSL11 glucan synthase-like 11 (.1)
AT2G36850 91 / 1e-21 CHOR, ATGSL8, ATGSL08 CHORUS, glucan synthase-like 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033689 190 / 5e-56 AT4G03550 2828 / 0.0 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1)
Lus10031648 186 / 1e-54 AT4G03550 2827 / 0.0 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1)
Lus10039828 179 / 5e-52 AT4G03550 2762 / 0.0 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1)
Lus10014601 173 / 7e-51 AT4G04970 635 / 0.0 GLUCAN SYNTHASE LIKE-1, GLUCAN SYNTHASE LIKE 1, glucan synthase-like 1 (.1)
Lus10030030 150 / 5e-42 AT4G03550 2251 / 0.0 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1)
Lus10000266 148 / 2e-41 AT4G03550 2613 / 0.0 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1)
Lus10037469 117 / 2e-30 AT1G05570 3143 / 0.0 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2)
Lus10003920 117 / 2e-30 AT1G05570 3231 / 0.0 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2)
Lus10039199 108 / 1e-27 AT5G13000 3524 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G052400 226 / 1e-68 AT4G04970 2583 / 0.0 GLUCAN SYNTHASE LIKE-1, GLUCAN SYNTHASE LIKE 1, glucan synthase-like 1 (.1)
Potri.013G131300 181 / 5e-53 AT4G03550 2752 / 0.0 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1)
Potri.001G230000 114 / 1e-29 AT5G13000 3157 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2)
Potri.001G012200 114 / 2e-29 AT5G13000 3492 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2)
Potri.003G214200 112 / 6e-29 AT5G13000 3363 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2)
Potri.005G058300 108 / 2e-27 AT2G13680 3190 / 0.0 ARABIDOPSIS THALIANA GLUCAN SYNTHASE-LIKE 2, callose synthase 5 (.1)
Potri.011G095100 99 / 2e-24 AT3G14570 2863 / 0.0 glucan synthase-like 4 (.1.2)
Potri.015G089300 96 / 3e-23 AT2G36850 3066 / 0.0 CHORUS, glucan synthase-like 8 (.1)
Potri.002G058700 95 / 9e-23 AT1G06490 2961 / 0.0 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1)
Potri.005G203500 94 / 1e-22 AT1G06490 2914 / 0.0 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1)
PFAM info
Representative CDS sequence
>Lus10032069 pacid=23161059 polypeptide=Lus10032069 locus=Lus10032069.g ID=Lus10032069.BGIv1.0 annot-version=v1.0
ATGGCCTCGAACTTCCCAGGACCTCCACAGCCCACGCGCGGCCCCTACCCACCGCACGCGCCGATGAATCACCACCAACCAGAAATCTACAACATAATCC
CTATCCACGACCTACTAACAGACCATCCCTCCCTCCGCTACCCGGAGGTCAGAGCCGCAGCCTCCCTGGTATTGCACTTAGCCAATTCCCAAATGCGCCT
CCAGCCGCCGCCGGTGCTTCCCGACGCCCTGGACCCCACCGTCCTCCGTCGCTTCCGCCGAAAGCTGCTCGCCAACTACACCTCCTGGTGCTCCTACATC
GGGAGGAGGTCGCAGCTGGTTTTCGCCGGTAGACCTAGCAGCGACGATCAAATCAGGAGGGAGTTGCTCTACGTCGGACTATACCTTCTAATTTGGGGAG
AATCTGGTAATGTTAGGTTTATGCCTGAGTGTATCTGTTACATTTATCACCATATGGCGATGGAGCTGAACCAATTCCTGGACGAATGGACTGATCCTGA
AACCGGTAGAGCCTTTCTCCCTTCCTTCTCACCTCCCTTCCTTCTCCGGTGA
AA sequence
>Lus10032069 pacid=23161059 polypeptide=Lus10032069 locus=Lus10032069.g ID=Lus10032069.BGIv1.0 annot-version=v1.0
MASNFPGPPQPTRGPYPPHAPMNHHQPEIYNIIPIHDLLTDHPSLRYPEVRAAASLVLHLANSQMRLQPPPVLPDALDPTVLRRFRRKLLANYTSWCSYI
GRRSQLVFAGRPSSDDQIRRELLYVGLYLLIWGESGNVRFMPECICYIYHHMAMELNQFLDEWTDPETGRAFLPSFSPPFLLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G04970 ATGSL01, ATGSL1 GLUCAN SYNTHASE LIKE-1, GLUCAN... Lus10032069 0 1
AT2G34680 AIR9 AUXIN-INDUCED IN ROOT CULTURES... Lus10038534 6.3 0.8973
AT3G02130 TOAD2, RPK2, CL... TOADSTOOL 2, clv3 peptide inse... Lus10007206 7.3 0.9091
AT4G29940 HD PRHA pathogenesis related homeodoma... Lus10020011 7.7 0.8769
AT5G04610 S-adenosyl-L-methionine-depend... Lus10023784 13.4 0.8283
Lus10020187 14.3 0.8233
AT1G04210 Leucine-rich repeat protein ki... Lus10021899 14.5 0.8968
AT4G27060 CN, SPR2, TOR1 TORTIFOLIA 1, SPIRAL 2, CONVOL... Lus10019616 16.2 0.8922
AT1G43770 RING/FYVE/PHD zinc finger supe... Lus10028603 16.7 0.8594
AT1G20960 EMB1507 embryo defective 1507, U5 smal... Lus10025169 19.0 0.9008
AT1G55350 EMB80, ATDEK1, ... EMBRYO DEFECTIVE 80, embryo de... Lus10013411 19.1 0.8993

Lus10032069 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.