Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27430 473 / 5e-171 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G40580 473 / 1e-170 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT4G31300 110 / 5e-29 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G13060 84 / 7e-19 PBE1 20S proteasome beta subunit E1 (.1.2) AT3G26340 83 / 1e-18 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT3G14290 61 / 9e-11 PAE2 20S proteasome alpha subunit E2 (.1) AT1G53850 60 / 2e-10 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT3G60820 54 / 2e-08 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT3G22110 51 / 2e-07 PAC1 20S proteasome alpha subunit C1 (.1) AT1G56450 48 / 3e-06 PBG1 20S proteasome beta subunit G1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014581 [exp] 555 / 0 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3) Lus10020180 [exp] 113 / 7e-30 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10026984 [exp] 111 / 3e-28 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10006426 [exp] 87 / 1e-19 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10011369 [exp] 86 / 2e-19 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10003936 [exp] 61 / 2e-10 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10037454 [exp] 61 / 3e-10 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10042145 [exp] 57 / 3e-09 AT3G22110 474 / 3e-172 20S proteasome alpha subunit C1 (.1) Lus10004235 [exp] 51 / 2e-07 AT3G22110 375 / 2e-134 20S proteasome alpha subunit C1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G066000 [exp] 495 / 1e-179 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.017G071100 [exp] 494 / 4e-179 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3) Potri.018G145900 [exp] 111 / 2e-29 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.006G077900 [exp] 110 / 6e-29 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.008G177000 [exp] 85 / 3e-19 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.010G058100 [exp] 85 / 4e-19 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.001G162900 [exp] 61 / 1e-10 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.003G072500 [exp] 60 / 2e-10 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1) Potri.006G008800 [exp] 54 / 3e-08 AT3G22110 452 / 1e-163 20S proteasome alpha subunit C1 (.1) Potri.006G242000 [exp] 52 / 1e-07 AT1G56450 399 / 1e-142 20S proteasome beta subunit G1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [flax] [poplar] NTN PF00227 [flax] [poplar] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Lus10032102 pacid=23161131 polypeptide=Lus10032102 locus=Lus10032102.g ID=Lus10032102.BGIv1.0 annot-version=v1.0 ATGCCGAGCTCGATGAAGATTGAGGCGCCTGCCAAGGGTGGCTTCAGTTTCGATCTATGCAAAAGAAACGAGATGCTTTCGGCGAAGGGTGGCAAGCCGC CTTCTTATAGGAAGACCGGAACTACCATCGTCGGCTTGATTTTCAAGGATGGTGTCGTTCTGGGAGCAGACACTAGAGCTACTGCAGGACCCATTGTCTG CGATAAGAATTGCGAGAAGATTCACTATATGGCTCCTAACATTTACTGCTGTGGAGCTGGAACTGCTGCTGATACCGAGGCAGTGACAGACATGGTAAGT TCACAGTTGCAGTTACATCGTTATCATACTGGTCGTGAGTCAAGGGTGATTACTGCACTCACTCTCCTCAAGAAGCATCTTTTCAATTACCAAGGACATG TCTCGGCTGCTTTGGTGCTTGGTGGTGTTGATTGCACTGGTCCACATTTGCATACCATATATCCACATGGATCAACAGACACTTTGCCATTTGCCACGAT GGGTTCTGGTTCCTTAGCTGCCATGTCTGTGTTCGAGTCGAAGTACAAGGAAGGCATGACTAGAGAGGAAGGAATCAAGTTGGTCACCGAGGCCATATGT TCTGGTATATTCAATGACTTGGGAAGTGGAAGCAATGTTGATGTTTGTGTCATTACAAAGGGGCACAAGGAATACATAAGAAACCACTTGCAACCAAATC CCCGTACATACCTCAGTGCACATGGGTACACTTTCCCTAAGAAGATAGAGATCCTCTCAACAAAGATCACTCCCTTGAAGGTGAAGGCGGCAGTGGCCGA GTCTGGTGATGCAATGGAAGAGTGA
AA sequence Show only first row Show all	>Lus10032102 pacid=23161131 polypeptide=Lus10032102 locus=Lus10032102.g ID=Lus10032102.BGIv1.0 annot-version=v1.0 MPSSMKIEAPAKGGFSFDLCKRNEMLSAKGGKPPSYRKTGTTIVGLIFKDGVVLGADTRATAGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVS SQLQLHRYHTGRESRVITALTLLKKHLFNYQGHVSAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFESKYKEGMTREEGIKLVTEAIC SGIFNDLGSGSNVDVCVITKGHKEYIRNHLQPNPRTYLSAHGYTFPKKIEILSTKITPLKVKAAVAESGDAMEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27430		PBB1	N-terminal nucleophile aminohy...		Lus10032102 [exp]	0	1
AT2G05840		PAA2	20S proteasome subunit PAA2 (....		Lus10027669 [exp]	1.0	0.8954
AT1G53850		PAE1, ATPAE1	ARABIDOPSIS 20S PROTEASOME ALP...		Lus10003936 [exp]	2.0	0.8552
AT2G19080			metaxin-related (.1)		Lus10015535 [exp]	2.4	0.8290
AT2G19080			metaxin-related (.1)		Lus10020010 [exp]	3.7	0.7984
AT5G05780		RPN8A, AE3, ATH...	ASYMMETRIC LEAVES ENHANCER 3, ...		Lus10035522 [exp]	4.9	0.8116
AT5G66140		PAD2	proteasome alpha subunit D2 (....		Lus10028437 [exp]	5.7	0.7763
AT2G19730			Ribosomal L28e protein family ...		Lus10006869 [exp]	7.2	0.8268
AT4G24820			26S proteasome, regulatory sub...		Lus10014789 [exp]	7.5	0.7715
AT2G27020		PAG1	20S proteasome alpha subunit G...		Lus10041296 [exp]	10.4	0.7739
AT1G04190		TPR3	tetratricopeptide repeat 3, Te...		Lus10041189 [exp]	12.7	0.7894

Compare expression of checked genes

Lus10032102 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.