Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032104 pacid=23161268 polypeptide=Lus10032104 locus=Lus10032104.g ID=Lus10032104.BGIv1.0 annot-version=v1.0 ATGGCGGCTGCCTTGCTGCTGATCAAGACGATGTTCTGTCTCTTCTTGCTCGGTCAGTTTTCAACACCATCGGCTTCCAGGCAACATTTCTCATCAGTTT CCAGGTCACCAGCAGCTGAGAAAGGGAACTGTCGTAGACAAACCTGGCGTGGCTACTCGGTGGTGGTCCGAGGACTATTCGTCTCCTCACAGACGAAGAC ATGTCCATAA
AA sequence Show only first row Show all	>Lus10032104 pacid=23161268 polypeptide=Lus10032104 locus=Lus10032104.g ID=Lus10032104.BGIv1.0 annot-version=v1.0 MAAALLLIKTMFCLFLLGQFSTPSASRQHFSSVSRSPAAEKGNCRRQTWRGYSVVVRGLFVSSQTKTCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032104 [exp]	0	1
AT1G75520		SRS5	SHI-related sequence 5 (.1)		Lus10003416 [exp]	1.7	0.8984
AT1G75520		SRS5	SHI-related sequence 5 (.1)		Lus10024305 [exp]	4.9	0.8506
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10012039 [exp]	15.0	0.8493
AT5G01750			Protein of unknown function (D...		Lus10022754 [exp]	21.9	0.8429
AT2G39530			Uncharacterised protein family...		Lus10031875 [exp]	29.3	0.7823
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Lus10040446 [exp]	43.6	0.8542
AT1G69550			disease resistance protein (TI...		Lus10038482 [exp]	50.3	0.8158
AT5G55250		AtIAMT1, IAMT1	IAA carboxylmethyltransferase ...		Lus10043177 [exp]	52.7	0.8413
					Lus10007977 [exp]	56.9	0.8461
AT1G21890			nodulin MtN21 /EamA-like trans...		Lus10021201 [exp]	87.2	0.8345

Compare expression of checked genes

Lus10032104 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.