Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03420 222 / 1e-75 Ku70-binding family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014579 [exp] 248 / 1e-85 AT3G03420 300 / 3e-105 Ku70-binding family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G339900 [exp] 221 / 5e-75 AT3G03420 295 / 2e-103 Ku70-binding family protein (.1) Potri.017G120800 [exp] 214 / 2e-72 AT3G03420 289 / 8e-101 Ku70-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0126 [flax] [poplar] Peptidase_MA PF09768 [flax] [poplar] Peptidase_M76 Peptidase M76 family
Representative CDS sequence Show only first row Show all	>Lus10032105 pacid=23161305 polypeptide=Lus10032105 locus=Lus10032105.g ID=Lus10032105.BGIv1.0 annot-version=v1.0 ATGGCAATTAGAGCGGCGGCTACACTCCCGATTCAAGTGTGCAGCAATGAAATGAATATACAAGATGAGGTCAATCAAGTTGTCATCCATGAACTGATCC ATGCTTTCGACGAGTGTCGTGCTGCAAACTTGGATTGGACCAATTGTCCTCACCATGCTTGCAGTGAGATTCGTGCTGGTCACTTGAGTGGTGATTGCAA CTACAAACGGGAGTTGCTGCGTGGCTTCATGAAAATTAGAGGTCATGAGCAAGAGTGCGTACGAAGAAGGGTCTTGAAATCACTCATGGGCAACCCATAC TGCTCAGAGGCTGCTGGAAAGGATGCCATGGAAGCGGTCTGGGATGTCTGCTACAACGATACACAACCTTTCGACAGAGCACCTTAA
AA sequence Show only first row Show all	>Lus10032105 pacid=23161305 polypeptide=Lus10032105 locus=Lus10032105.g ID=Lus10032105.BGIv1.0 annot-version=v1.0 MAIRAAATLPIQVCSNEMNIQDEVNQVVIHELIHAFDECRAANLDWTNCPHHACSEIRAGHLSGDCNYKRELLRGFMKIRGHEQECVRRRVLKSLMGNPY CSEAAGKDAMEAVWDVCYNDTQPFDRAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03420			Ku70-binding family protein (....		Lus10032105 [exp]	0	1
AT5G24060			Pentatricopeptide repeat (PPR)...		Lus10027532 [exp]	5.6	0.8651
AT2G22650			FAD-dependent oxidoreductase f...		Lus10036320 [exp]	5.8	0.8551
AT5G08010			unknown protein		Lus10040520 [exp]	8.7	0.8461
AT3G06510		SFR2, ATSFR2	SENSITIVE TO FREEZING 2, Glyco...		Lus10043048 [exp]	9.8	0.8184
AT5G46560			unknown protein		Lus10011046 [exp]	10.1	0.8411
AT3G05290		AtPNC1, PNC1	peroxisomal adenine nucleotide...		Lus10010517 [exp]	10.2	0.8337
AT4G27800		TAP38, PPH1	PROTEIN PHOSPHATASE 1, thylako...		Lus10005908 [exp]	16.4	0.8275
AT5G01260			Carbohydrate-binding-like fold...		Lus10004826 [exp]	16.6	0.8430
AT5G55760		SRT1	sirtuin 1 (.1)		Lus10016619 [exp]	18.2	0.8273
AT2G26280		CID7	CTC-interacting domain 7 (.1)		Lus10009796 [exp]	18.9	0.8373

Compare expression of checked genes

Lus10032105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.