Lus10032107 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40630 127 / 2e-37 Ubiquitin-like superfamily protein (.1)
AT5G14360 124 / 2e-36 Ubiquitin-like superfamily protein (.1)
AT3G51780 78 / 2e-17 ATBAG4 BCL-2-associated athanogene 4 (.1)
AT5G62100 76 / 3e-17 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3)
AT5G52060 71 / 1e-14 ATBAG1 BCL-2-associated athanogene 1 (.1)
AT5G07220 68 / 1e-13 ATBAG3 BCL-2-associated athanogene 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022315 147 / 8e-45 AT5G14360 158 / 2e-49 Ubiquitin-like superfamily protein (.1)
Lus10014884 140 / 6e-42 AT5G14360 158 / 2e-49 Ubiquitin-like superfamily protein (.1)
Lus10005051 97 / 8e-24 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1)
Lus10027822 93 / 9e-23 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1)
Lus10023279 79 / 6e-18 AT5G07220 196 / 4e-62 BCL-2-associated athanogene 3 (.1)
Lus10027420 79 / 2e-17 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1)
Lus10038882 75 / 6e-16 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1)
Lus10015004 74 / 1e-15 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1)
Lus10006328 72 / 3e-15 AT5G52060 194 / 2e-60 BCL-2-associated athanogene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G339100 144 / 7e-44 AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1)
Potri.009G074300 103 / 4e-27 AT3G51780 196 / 4e-62 BCL-2-associated athanogene 4 (.1)
Potri.001G279500 101 / 4e-26 AT3G51780 210 / 2e-67 BCL-2-associated athanogene 4 (.1)
Potri.015G135500 82 / 1e-18 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1)
Potri.001G358200 79 / 1e-17 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1)
Potri.001G110300 77 / 1e-16 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1)
Potri.012G133400 76 / 3e-16 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1)
Potri.003G121500 74 / 9e-16 AT5G52060 243 / 1e-78 BCL-2-associated athanogene 1 (.1)
Potri.016G121200 63 / 6e-12 AT3G51780 218 / 1e-70 BCL-2-associated athanogene 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
Representative CDS sequence
>Lus10032107 pacid=23161134 polypeptide=Lus10032107 locus=Lus10032107.g ID=Lus10032107.BGIv1.0 annot-version=v1.0
ATGTTGAAGTTAAAGTCCAAGAAGTTTTGCAGAGGGATCAGCTTCAAGCTAATTGGTGGGAGCAAAGGGAATAGTTCTACTTCTAGCAGTAATCATAAGA
AGGGATCATCTTCATCATCTTCATCTTCATCTTCTTCTTCTTCTTCTTCTCATAATATCAGTGAAATAAAATGGGAGGTTAGGCCTGGTGGGATGCTGGT
TCAGAAAAGACAGAGTATTGATGATCATGATGATACCACCTTTAATGGTGATGAGTTGATCACACTCAAAGTTACAACTGTTTCGCAATCCCACCATCAT
ATCTCCATTGAACCCACTTCCACCTTTGGGGAATTGAAGGTGGTGTTGGAGATGGTGACAAAGATGGAGGCAAGGGAGCAAAGGGTATTGTACAGAGGGA
AAGAGAGGGGAGATGATGAGTATCTACATATGGTTGGGGTGAGAGACAAAGACAAACTTCTTCTTTTGGAATATCCAGCCATCAAAGAAGAGAAGATGCT
GCTCAGAAGAAGAAGACTCCATGGCTTGTCCTCTCCTTCATCTGCCCCCAACTATCCACCTACCTTCCGTACCATTAGTGTATAG
AA sequence
>Lus10032107 pacid=23161134 polypeptide=Lus10032107 locus=Lus10032107.g ID=Lus10032107.BGIv1.0 annot-version=v1.0
MLKLKSKKFCRGISFKLIGGSKGNSSTSSSNHKKGSSSSSSSSSSSSSSSHNISEIKWEVRPGGMLVQKRQSIDDHDDTTFNGDELITLKVTTVSQSHHH
ISIEPTSTFGELKVVLEMVTKMEAREQRVLYRGKERGDDEYLHMVGVRDKDKLLLLEYPAIKEEKMLLRRRRLHGLSSPSSAPNYPPTFRTISV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40630 Ubiquitin-like superfamily pro... Lus10032107 0 1
AT2G28760 UXS6 UDP-XYL synthase 6 (.1.2.3) Lus10001707 1.7 0.9660
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10040697 4.5 0.9287
AT1G72230 Cupredoxin superfamily protein... Lus10020944 4.5 0.9101
AT2G28760 UXS6 UDP-XYL synthase 6 (.1.2.3) Lus10001705 4.7 0.9485
AT2G28760 UXS6 UDP-XYL synthase 6 (.1.2.3) Lus10005155 6.9 0.9082
AT1G72230 Cupredoxin superfamily protein... Lus10008720 7.1 0.8933
AT3G27200 Cupredoxin superfamily protein... Lus10041570 7.1 0.9425
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10032894 8.1 0.9257
AT1G73140 TBL31 Plant protein of unknown funct... Lus10042845 9.8 0.9408
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10041481 14.7 0.9172

Lus10032107 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.