Lus10032120 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G34620 270 / 5e-90 Mitochondrial transcription termination factor family protein (.1)
AT2G03050 195 / 7e-61 SOLDAT10, EMB93 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
AT2G36000 139 / 9e-39 EMB3114 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
AT3G18870 131 / 3e-36 Mitochondrial transcription termination factor family protein (.1)
AT1G78930 105 / 5e-25 Mitochondrial transcription termination factor family protein (.1)
AT4G14605 100 / 3e-23 Mitochondrial transcription termination factor family protein (.1)
AT2G21710 92 / 1e-20 EMB2219 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
AT5G55580 86 / 1e-18 Mitochondrial transcription termination factor family protein (.1)
AT4G38160 74 / 6e-15 PDE191 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
AT2G44020 61 / 3e-10 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014567 472 / 1e-168 AT2G34620 300 / 6e-101 Mitochondrial transcription termination factor family protein (.1)
Lus10030451 162 / 2e-47 AT2G03050 283 / 3e-95 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
Lus10026612 160 / 4e-47 AT2G03050 285 / 4e-96 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
Lus10016971 151 / 3e-43 AT2G36000 271 / 2e-89 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10021297 150 / 5e-43 AT2G36000 264 / 8e-87 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10029422 142 / 2e-39 AT2G36000 294 / 3e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10004219 140 / 5e-39 AT2G36000 293 / 8e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10042342 129 / 5e-35 AT3G18870 276 / 1e-92 Mitochondrial transcription termination factor family protein (.1)
Lus10026325 128 / 2e-34 AT3G18870 278 / 3e-93 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G081400 288 / 7e-97 AT2G34620 392 / 5e-138 Mitochondrial transcription termination factor family protein (.1)
Potri.010G167400 157 / 4e-46 AT2G03050 303 / 3e-103 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
Potri.016G072200 155 / 2e-44 AT2G36000 280 / 1e-92 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Potri.006G205000 151 / 4e-43 AT2G36000 284 / 2e-94 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Potri.004G150600 127 / 1e-34 AT3G18870 311 / 1e-106 Mitochondrial transcription termination factor family protein (.1)
Potri.007G001800 116 / 5e-29 AT1G78930 633 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.017G067600 97 / 3e-22 AT4G14605 571 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.001G361800 89 / 2e-19 AT5G55580 584 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.009G116200 86 / 2e-18 AT2G21710 748 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Potri.004G209400 74 / 6e-15 AT4G38160 481 / 3e-172 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10032120 pacid=23161121 polypeptide=Lus10032120 locus=Lus10032120.g ID=Lus10032120.BGIv1.0 annot-version=v1.0
ATGTCGTCGTCGTTACACTCTGCATTCTCCATTGCAGCATCATCACAAGCTCCTGCAGATCCACACCACCATCAATACACCATTTCTTCAACAAAGCTCT
CAGCCAAACCAACAAACAACAACAAAACCAAAACCCTCCACTTGAACAACCCACTCCTCCACAAAAACCTCACCACCCAAATCAAGGAGAAAATCCTCTG
CCTCGAAATCATGGGCGTCGACTCCGGCAAGGCCCTCTCCAAAAACCCAGACCTCCACTCCGCTTCCCTCGACTCAATCCACGTTATCATCTCCTTCCTC
CACTCAAAAGGCATCCACCACAAGGACTTCCCTCGAATCTTCGGAATGTGCCCTCAGCTCCTCACTTCCGACGTCGCATCACACCTCTCCCCTGTCTTCT
ACTTCCTCTCCGACGATCTCAAAGTCCCCGACTACAAATTCCGGAAAATCATCACCAAATGCCCCCGCATTTTGACTTCCGACGTTGACCGCCAACTCAG
ACCTAACTCAACCTACCTGAGGGATACGATCGGGTTCCAACAGCGGCAATTGGAAACCCTAATTTACACCGATCCGGTTCTGTTAGTCTCCAGCGTGGAG
AATACTCTGGTTCCTAAACTCAAGTACTTGGAGGAAGGGATTGGACTGACGGAGGACGAGATTTTCGGGATGGTGAGGAGGTTTCCGTCGTTGTTGACGT
TTAGTGTGGAGAATAATTTGAAGCCTAAGTATGAGTTCTTTGTTGGGGGGATGGAAGGGAGAGGATTGGAGGAGATTAAGGCGTTTCCGCATTATTTTGG
GTTTAGTTTGGAGAATCGGATCAAGCCGAGGTACTTGCAGGTTCTGGAGAGAGGGATGATGACGATGCCTCTTCCTCTTCTGCTCAAGACCACTGATCCT
CAGTTCCAGCTGCTACTTTCTCAGACCTCCTCTGTATAG
AA sequence
>Lus10032120 pacid=23161121 polypeptide=Lus10032120 locus=Lus10032120.g ID=Lus10032120.BGIv1.0 annot-version=v1.0
MSSSLHSAFSIAASSQAPADPHHHQYTISSTKLSAKPTNNNKTKTLHLNNPLLHKNLTTQIKEKILCLEIMGVDSGKALSKNPDLHSASLDSIHVIISFL
HSKGIHHKDFPRIFGMCPQLLTSDVASHLSPVFYFLSDDLKVPDYKFRKIITKCPRILTSDVDRQLRPNSTYLRDTIGFQQRQLETLIYTDPVLLVSSVE
NTLVPKLKYLEEGIGLTEDEIFGMVRRFPSLLTFSVENNLKPKYEFFVGGMEGRGLEEIKAFPHYFGFSLENRIKPRYLQVLERGMMTMPLPLLLKTTDP
QFQLLLSQTSSV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G34620 Mitochondrial transcription te... Lus10032120 0 1
AT1G67740 YCF32, PSBY photosystem II BY (.1) Lus10006243 1.0 0.9370
AT1G15820 CP24, LHCB6 light harvesting complex photo... Lus10015834 2.4 0.9335
AT2G34620 Mitochondrial transcription te... Lus10014567 2.8 0.9157
AT1G18060 unknown protein Lus10041995 3.2 0.9206
AT1G15820 CP24, LHCB6 light harvesting complex photo... Lus10020415 3.9 0.9253
AT5G24930 CO COL4, ATCOL4 CONSTANS-like 4 (.1) Lus10026909 4.2 0.8891
AT1G20340 PETE2, DRT112 PLASTOCYANIN 2, DNA-DAMAGE-REP... Lus10034554 4.5 0.9246
AT3G63540 Mog1/PsbP/DUF1795-like photosy... Lus10016419 7.9 0.9086
AT1G74470 Pyridine nucleotide-disulphide... Lus10021665 8.1 0.9192
AT4G14540 CCAAT NF-YB3 "nuclear factor Y, subunit B3"... Lus10022514 8.5 0.8780

Lus10032120 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.