Lus10032127 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40420 114 / 4e-32 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT3G01570 100 / 5e-27 Oleosin family protein (.1)
AT3G27660 100 / 7e-27 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
AT5G51210 55 / 6e-10 OLEO3 oleosin3 (.1)
AT2G25890 55 / 1e-09 Oleosin family protein (.1)
AT4G25140 52 / 1e-08 OLE1, OLEO1 oleosin 1 (.1)
AT5G07550 44 / 3e-06 ATGRP19, GRP19 glycine-rich protein 19 (.1.2.3)
AT5G61610 45 / 1e-05 Oleosin family protein (.1)
AT5G07571 42 / 3e-05 Oleosin family protein (.1)
AT5G07560 40 / 0.0002 ATGRP20, GRP20 glycine-rich protein 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014559 211 / 3e-70 AT3G01570 159 / 1e-49 Oleosin family protein (.1)
Lus10003742 102 / 8e-28 AT3G01570 142 / 1e-43 Oleosin family protein (.1)
Lus10028035 100 / 8e-27 AT3G01570 139 / 8e-42 Oleosin family protein (.1)
Lus10028822 73 / 1e-16 AT4G25140 146 / 3e-46 oleosin 1 (.1)
Lus10017460 73 / 2e-16 AT4G25140 136 / 9e-42 oleosin 1 (.1)
Lus10031387 66 / 6e-14 AT4G25140 164 / 1e-52 oleosin 1 (.1)
Lus10027161 66 / 8e-14 AT4G25140 154 / 3e-48 oleosin 1 (.1)
Lus10010943 66 / 1e-12 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10039683 61 / 5e-12 AT4G25140 159 / 2e-50 oleosin 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G345800 134 / 2e-40 AT3G01570 140 / 6e-43 Oleosin family protein (.1)
Potri.017G071800 126 / 2e-37 AT3G01570 130 / 4e-39 Oleosin family protein (.1)
Potri.012G083400 99 / 1e-26 AT5G40420 97 / 2e-25 oleosin 2 (.1)
Potri.015G081901 98 / 3e-26 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.T125308 98 / 3e-26 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.001G080000 56 / 3e-10 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.006G234900 56 / 4e-10 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.003G150600 53 / 3e-09 AT4G25140 124 / 3e-37 oleosin 1 (.1)
Potri.018G057800 50 / 3e-08 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.012G059400 38 / 0.001 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Lus10032127 pacid=23161052 polypeptide=Lus10032127 locus=Lus10032127.g ID=Lus10032127.BGIv1.0 annot-version=v1.0
ATGGCGGATCGTACAACACAGCCACACCAAGTCCAGGTCCACACCCAGCACCACTATCCCACCGGCGGGGCTTTCGGCCGTTATGAAGGTGGACTCAAAG
GCGGTCCACATCACCAGCAAGGATCAGGCAGCGGCCCATCAGCTTCCAAGGTGTTAGCAGTCATGACCGCGCTCCCCATCGGCGGGACCCTCCTTGCCTT
GGCCGGGATAACCTTGGCTGGGACGATGATCGGGCTGGCGATCACCACCCCGATTTTTGTCATCTGCAGCCCTGTTCTAGTCCCGGCCGCTCTGCTCATC
GGGTTTGCCGTGAGCGCGTTTCTGGCCTCGGGGATGGCCGGGCTGACAGGGCTGACCTCGCTGTCGTGGTTTGCGAGGTATCTGCAGCAGGCTGGGCAGG
GAGTTGGAGTGGGGGTGCCGGATAGTTTCGAGCAGGCGAAGAGGCGCATGCAGGATGCTGCTGGGTATATGGGGCAGAAGACCAAGGAAGTTGGGCAGGA
GATCCAGAGGAAGTCTCAGGATGTGAAAGCATCAGACAAATAA
AA sequence
>Lus10032127 pacid=23161052 polypeptide=Lus10032127 locus=Lus10032127.g ID=Lus10032127.BGIv1.0 annot-version=v1.0
MADRTTQPHQVQVHTQHHYPTGGAFGRYEGGLKGGPHHQQGSGSGPSASKVLAVMTALPIGGTLLALAGITLAGTMIGLAITTPIFVICSPVLVPAALLI
GFAVSAFLASGMAGLTGLTSLSWFARYLQQAGQGVGVGVPDSFEQAKRRMQDAAGYMGQKTKEVGQEIQRKSQDVKASDK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G01570 Oleosin family protein (.1) Lus10032127 0 1
AT5G62030 diphthamide synthesis DPH2 fam... Lus10039108 11.0 0.6988
Lus10010972 15.7 0.7159
AT5G40190 RNA ligase/cyclic nucleotide p... Lus10014523 18.4 0.6869
AT3G13130 unknown protein Lus10039066 25.7 0.6884
AT3G11690 unknown protein Lus10013608 27.3 0.6861
Lus10039242 30.0 0.6484
AT5G47830 unknown protein Lus10018732 33.9 0.6811
AT3G58030 RING/U-box superfamily protein... Lus10004162 42.3 0.6713
AT3G18590 AtENODL5 early nodulin-like protein 5 (... Lus10022522 44.0 0.6763
AT2G18050 HIS1-3 histone H1-3 (.1.2) Lus10025968 44.6 0.6760

Lus10032127 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.