Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014537 [exp] 50 / 4e-08 AT3G16180 174 / 4e-49 Major facilitator superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0396 [flax] [poplar] Marvel-like PF04535 [flax] [poplar] DUF588 Domain of unknown function (DUF588)
Representative CDS sequence Show only first row Show all	>Lus10032147 pacid=23161104 polypeptide=Lus10032147 locus=Lus10032147.g ID=Lus10032147.BGIv1.0 annot-version=v1.0 ATGGTGGGTCAATGTCCTTTTCCATGGAAGGTCGTTGCTGGCGTTGGAATATTTTGGGCCATTTTACAAACTAATGATGATTGGATCCAAATTTTCCTTG ATGGGTTGAAAGTGGGTTACAGAATCGTCACTCACTCTGGGAATTTGGGACCAGTAATGGCGTATCTGCTGTTATCAGCATCAACAACAGCGGCGTACAG AGTGGAAGAGTGGGAATCAAACTGGGGGAAAGACCAATTTCCAACTATGGCAAGAGCATCTCTGTCGCTCTCCTTCTTAGCATTTCTTGCCTTTGCATTC ACCTCCCTTCTTTCTGGTTACTCTCTCTTCACTTCTAACTCATTCTAG
AA sequence Show only first row Show all	>Lus10032147 pacid=23161104 polypeptide=Lus10032147 locus=Lus10032147.g ID=Lus10032147.BGIv1.0 annot-version=v1.0 MVGQCPFPWKVVAGVGIFWAILQTNDDWIQIFLDGLKVGYRIVTHSGNLGPVMAYLLLSASTTAAYRVEEWESNWGKDQFPTMARASLSLSFLAFLAFAF TSLLSGYSLFTSNSF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36330			Uncharacterised protein family...		Lus10032147 [exp]	0	1
AT3G28917	ZF_HD	MIF2	mini zinc finger 2 (.1)		Lus10033016 [exp]	1.0	0.9282
AT2G18030			Peptide methionine sulfoxide r...		Lus10041922 [exp]	3.2	0.8925
AT2G26690			Major facilitator superfamily ...		Lus10018553 [exp]	3.7	0.8984
AT2G36330			Uncharacterised protein family...		Lus10032148 [exp]	3.9	0.8969
AT4G29800		PLP8, PLAIVD ,P...	PATATIN-like protein 8 (.1.2)		Lus10036213 [exp]	4.0	0.8935
AT4G02500		ATXT2, XXT2	XYG XYLOSYLTRANSFERASE 2, ARAB...		Lus10037519 [exp]	8.4	0.8757
AT2G26690			Major facilitator superfamily ...		Lus10039782 [exp]	8.5	0.8797
AT3G15350			Core-2/I-branching beta-1,6-N-...		Lus10019477 [exp]	9.8	0.8906
AT4G02500		ATXT2, XXT2	XYG XYLOSYLTRANSFERASE 2, ARAB...		Lus10037520 [exp]	10.5	0.8719
AT2G25110		AtSDF2, ATSDL, ...	ATSDF2-LIKE, Arabidopsis thali...		Lus10019365 [exp]	12.7	0.8841

Compare expression of checked genes

Lus10032147 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.