Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014530 [exp] 43 / 4e-06 AT5G11770 360 / 4e-128 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032156 pacid=23161149 polypeptide=Lus10032156 locus=Lus10032156.g ID=Lus10032156.BGIv1.0 annot-version=v1.0 ATGGCTATGATCACCAGAAACACCGCCTCTCGCCTCCCTCTCCTCCTCGCCAACCACCATGCTGGCCTCGCTGCTGCTCTCCACACCACCGTCCCCTCGC CATCCCCTGATAACGCAACCAAACCGACTTCCTACGCCCCGCCACCGCCTCCGGCTACCCCTTCCCCCGCTGGCCTCTCCAAGCCACCCGCGCCCCTTCC AAGACGGCCGAATTCGTGA
AA sequence Show only first row Show all	>Lus10032156 pacid=23161149 polypeptide=Lus10032156 locus=Lus10032156.g ID=Lus10032156.BGIv1.0 annot-version=v1.0 MAMITRNTASRLPLLLANHHAGLAAALHTTVPSPSPDNATKPTSYAPPPPPATPSPAGLSKPPAPLPRRPNS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G11770			NADH-ubiquinone oxidoreductase...		Lus10032156 [exp]	0	1
AT3G48590	CCAAT	NF-YC1, ATHAP5A...	"nuclear factor Y, subunit C1"...		Lus10016750 [exp]	5.5	0.8416
AT1G32580			plastid developmental protein ...		Lus10023744 [exp]	7.0	0.8442
AT3G02920		ATRPA32B	Replication protein A, subunit...		Lus10019976 [exp]	25.3	0.8057
AT3G50940			P-loop containing nucleoside t...		Lus10024275 [exp]	28.0	0.8135
AT2G27260			Late embryogenesis abundant (L...		Lus10034173 [exp]	36.0	0.8253
AT3G48590	CCAAT	NF-YC1, ATHAP5A...	"nuclear factor Y, subunit C1"...		Lus10022444 [exp]	43.4	0.7989
AT1G61730	GeBP		DNA-binding storekeeper protei...		Lus10010076 [exp]	51.9	0.7909
AT4G19950			unknown protein		Lus10018322 [exp]	59.7	0.7837
AT4G03120			C2H2 and C2HC zinc fingers sup...		Lus10011434 [exp]	66.6	0.7945
AT3G16300			Uncharacterised protein family...		Lus10025833 [exp]	85.4	0.7831

Compare expression of checked genes

Lus10032156 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.