Lus10032157 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11770 242 / 5e-83 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
ATCG00430 121 / 2e-35 ATCG00430.1, PSBG photosystem II reaction center protein G (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039485 248 / 4e-85 AT5G11770 352 / 4e-125 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
Lus10032155 244 / 6e-85 AT5G11770 277 / 7e-97 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
Lus10014530 247 / 7e-85 AT5G11770 360 / 4e-128 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G231701 240 / 3e-82 AT5G11770 303 / 7e-106 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
Potri.013G163100 120 / 9e-35 ATCG00430 409 / 4e-147 photosystem II reaction center protein G (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Representative CDS sequence
>Lus10032157 pacid=23161157 polypeptide=Lus10032157 locus=Lus10032157.g ID=Lus10032157.BGIv1.0 annot-version=v1.0
ATGACTTTCGGGCTCGCTTGCTGCGCTGTCGAGATGATGCACACGGGTGCGGCACGCTACGATCTGGATCGGTTTGGTGTCATTTTCAGGCCTAGCCCTC
GTCAGTCTGATTGTATGATTGTAGCCGGCACCTTAACTAACAAGATGGCTCCTGCTCTTCGCAAGGTGTACGACCAAATGCCAGAGCCGAGATGGGTCAT
CTCCATGGGAAGCTGTGCAAATGGTGGCGGTTACTATCACTACTCGTACTCTGTTGTACGCGGTTGCGACAGGATTGTCCCCGTTGACATATACGTCCCA
GGGTGCCCTCCCACTGCCGAGGCACTACTCTATGGGATCCTCCAGCTGCAGAAGAAGATCAACAGACGCAAAGATCTCATGCATTGGTGGACCAAATAA
AA sequence
>Lus10032157 pacid=23161157 polypeptide=Lus10032157 locus=Lus10032157.g ID=Lus10032157.BGIv1.0 annot-version=v1.0
MTFGLACCAVEMMHTGAARYDLDRFGVIFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
GCPPTAEALLYGILQLQKKINRRKDLMHWWTK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G11770 NADH-ubiquinone oxidoreductase... Lus10032157 0 1
AT2G37110 PLAC8 family protein (.1) Lus10026492 1.0 0.9236
AT5G10730 NAD(P)-binding Rossmann-fold s... Lus10020108 1.4 0.9200
AT5G65720 ATNIFS1, NIFS1 ... NITROGEN FIXATION S HOMOLOG 1,... Lus10011590 2.2 0.9001
AT4G10040 CYTC-2 cytochrome c-2 (.1) Lus10008922 3.2 0.8904
AT5G11770 NADH-ubiquinone oxidoreductase... Lus10032155 4.2 0.9034
AT4G18700 ATWL4, CIPK12, ... SNF1-RELATED PROTEIN KINASE 3.... Lus10025397 4.6 0.8999
AT4G09670 Oxidoreductase family protein ... Lus10001327 4.7 0.8890
AT3G08690 ATUBC11, UBC11 ubiquitin-conjugating enzyme 1... Lus10028700 4.9 0.8886
AT1G29260 PEX7, ATPEX7 ARABIDOPSIS PEROXIN 7, peroxin... Lus10029221 5.2 0.8952
AT4G09670 Oxidoreductase family protein ... Lus10013633 5.5 0.9000

Lus10032157 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.