Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14920 42 / 3e-05 Gibberellin-regulated family protein (.1.2) AT1G75750 40 / 3e-05 GASA1 GAST1 protein homolog 1 (.1.2) AT2G18420 39 / 8e-05 Gibberellin-regulated family protein (.1) AT1G22690 39 / 0.0001 Gibberellin-regulated family protein (.1.2.3) AT4G09600 39 / 0.0001 GASA3 GAST1 protein homolog 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014519 [exp] 197 / 4e-67 AT5G14920 44 / 5e-06 Gibberellin-regulated family protein (.1.2) Lus10039443 [exp] 45 / 2e-06 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2) Lus10017212 [exp] 39 / 5e-05 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2) Lus10034524 [exp] 38 / 0.0003 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G239100 [exp] 43 / 2e-06 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2) Potri.001G350600 [exp] 44 / 3e-06 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2) Potri.013G113400 [exp] 42 / 4e-06 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.012G076700 [exp] 39 / 0.0002 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1) Potri.002G022500 [exp] 39 / 0.0002 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.002G022700 [exp] 38 / 0.0002 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2) Potri.015G071500 [exp] 38 / 0.0003 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2) Potri.002G022600 [exp] 37 / 0.0003 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10032168 pacid=23161217 polypeptide=Lus10032168 locus=Lus10032168.g ID=Lus10032168.BGIv1.0 annot-version=v1.0 ATGGCTCTCATCAAAGCTGCCTGCATCCTCTTCTTCCTAGCCTACCTCACCTCCAATGTTTATTCAGCTGAAGTAGATTCTGAGAAATCTCCAGCTGCTG TCGTCGCTGCTGCTGATGCTCCGGTGTACGTAGCGCAGTCACCAATGTCGAATTTCCGGGGAGAATACTGCCTCGACAGGTGCGAGGATCGGTGCAAGAC GCACCCGAACAGGAAGAGGATGTGCCAGAAGCTATGCACAAGGTGTTGCATGAGCTGCAAGTGTGTGCCGCCTGGCCCTGTTGGTACCAATGCTGATAAG TGCAAGAACTGGACCGCCACTGTTTACAAAGGCCTCCCTTACATTTGCCCTTAA
AA sequence Show only first row Show all	>Lus10032168 pacid=23161217 polypeptide=Lus10032168 locus=Lus10032168.g ID=Lus10032168.BGIv1.0 annot-version=v1.0 MALIKAACILFFLAYLTSNVYSAEVDSEKSPAAVVAAADAPVYVAQSPMSNFRGEYCLDRCEDRCKTHPNRKRMCQKLCTRCCMSCKCVPPGPVGTNADK CKNWTATVYKGLPYICP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14920			Gibberellin-regulated family p...		Lus10032168 [exp]	0	1
AT3G24750			unknown protein		Lus10025939 [exp]	1.4	0.9758
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10026040 [exp]	1.4	0.9729
AT2G17080			Arabidopsis protein of unknown...		Lus10023964 [exp]	6.3	0.9550
AT2G12646			PLATZ transcription factor fam...		Lus10008814 [exp]	6.7	0.9501
AT2G17080			Arabidopsis protein of unknown...		Lus10023965 [exp]	6.9	0.9545
AT2G17080			Arabidopsis protein of unknown...		Lus10023963 [exp]	7.1	0.9465
AT3G24750			unknown protein		Lus10038162 [exp]	7.7	0.9605
AT1G50060			CAP (Cysteine-rich secretory p...		Lus10025697 [exp]	8.4	0.9263
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Lus10023109 [exp]	8.7	0.9236
AT5G24070			Peroxidase superfamily protein...		Lus10004804 [exp]	9.5	0.9280

Compare expression of checked genes

Lus10032168 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.