Lus10032170 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40150 281 / 1e-95 Peroxidase superfamily protein (.1)
AT3G28200 278 / 1e-94 Peroxidase superfamily protein (.1)
AT5G47000 217 / 2e-70 Peroxidase superfamily protein (.1)
AT1G24110 211 / 2e-68 Peroxidase superfamily protein (.1)
AT4G17690 198 / 3e-63 Peroxidase superfamily protein (.1)
AT2G18980 152 / 2e-45 Peroxidase superfamily protein (.1)
AT4G37520 150 / 2e-44 Peroxidase superfamily protein (.1.2)
AT5G67400 149 / 5e-44 RHS19 root hair specific 19 (.1)
AT4G37530 147 / 2e-43 Peroxidase superfamily protein (.1.2)
AT5G14130 144 / 4e-42 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014517 394 / 3e-142 AT5G40150 280 / 2e-95 Peroxidase superfamily protein (.1)
Lus10039471 331 / 2e-117 AT5G40150 290 / 2e-99 Peroxidase superfamily protein (.1)
Lus10039445 334 / 1e-116 AT5G40150 467 / 8e-167 Peroxidase superfamily protein (.1)
Lus10029201 236 / 2e-79 AT1G24110 288 / 6e-98 Peroxidase superfamily protein (.1)
Lus10010716 238 / 7e-79 AT1G24110 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10004234 216 / 3e-70 AT1G24110 391 / 1e-136 Peroxidase superfamily protein (.1)
Lus10042144 215 / 1e-69 AT1G24110 390 / 2e-136 Peroxidase superfamily protein (.1)
Lus10013955 158 / 1e-46 AT2G34060 451 / 1e-158 Peroxidase superfamily protein (.1)
Lus10011079 155 / 2e-46 AT4G37530 479 / 2e-171 Peroxidase superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G351000 280 / 2e-95 AT3G28200 448 / 2e-159 Peroxidase superfamily protein (.1)
Potri.010G036100 241 / 4e-80 AT1G24110 400 / 2e-140 Peroxidase superfamily protein (.1)
Potri.012G076500 236 / 4e-78 AT4G17690 423 / 1e-149 Peroxidase superfamily protein (.1)
Potri.007G074700 178 / 2e-55 AT5G47000 358 / 8e-124 Peroxidase superfamily protein (.1)
Potri.004G052100 158 / 2e-47 AT2G34060 458 / 1e-162 Peroxidase superfamily protein (.1)
Potri.007G053400 156 / 7e-47 AT5G67400 471 / 4e-168 root hair specific 19 (.1)
Potri.001G329200 152 / 2e-45 AT4G37530 392 / 4e-137 Peroxidase superfamily protein (.1.2)
Potri.017G064100 152 / 3e-45 AT5G67400 372 / 2e-129 root hair specific 19 (.1)
Potri.018G089900 146 / 6e-43 AT4G30170 472 / 6e-169 Peroxidase family protein (.1)
Potri.008G103200 145 / 1e-42 AT4G16270 438 / 1e-154 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10032170 pacid=23161274 polypeptide=Lus10032170 locus=Lus10032170.g ID=Lus10032170.BGIv1.0 annot-version=v1.0
ATGGTCGGCGGCCCCTTCTACGACGTCCCGCTCGGCCGCCTCGACTACCGCGTCTCCAAATCCTCCGCCGTTCCCGGAAACCTCCCGCTGCCGTCGACCC
CGATGTCGCAGATGATCGACATGTTCGCCGCCAGGGGATTCTCCGTCCAAGAGATGGTCGCTCTTAGCGGGGCCCACACCATCGGATTCTCCCACTGTGA
AGAGTTCAGCGGAGATCTGTACAACACCACCGCCACGGCGGGGGGAAGTAACTACAATCCGCGATTCGCAGCGGCGTTGCAGAAGGCGTGCGCGAATTAC
AAGAAGGACCCGTCGATCTCGGTGTTCAACGATATAATGACACCGAACAAATTCGACAATGTGTACTACCAGAACTTGCCCAAGGGGCTGGGACTGCTGA
AGTCGGACCATGGATTGGTGAAAGACGATCGCACCCGGCCGTTTGTGGAGATTTATGCGAAAGATCAGAACAAGTTTTTCAAGGATTTCGCCACTGCGAT
GCAGAAGCTGAGCGTGTATGGTATCAAGACTGGGAGACGAGGCGAGATTAGGCACAGGTGCGATGCTGCCAACTGA
AA sequence
>Lus10032170 pacid=23161274 polypeptide=Lus10032170 locus=Lus10032170.g ID=Lus10032170.BGIv1.0 annot-version=v1.0
MVGGPFYDVPLGRLDYRVSKSSAVPGNLPLPSTPMSQMIDMFAARGFSVQEMVALSGAHTIGFSHCEEFSGDLYNTTATAGGSNYNPRFAAALQKACANY
KKDPSISVFNDIMTPNKFDNVYYQNLPKGLGLLKSDHGLVKDDRTRPFVEIYAKDQNKFFKDFATAMQKLSVYGIKTGRRGEIRHRCDAAN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40150 Peroxidase superfamily protein... Lus10032170 0 1
AT5G40150 Peroxidase superfamily protein... Lus10014517 1.0 0.9425
AT4G37450 ATAGP18, AGP18 arabinogalactan protein 18 (.... Lus10011520 1.4 0.8719
AT3G51790 ATG1 transmembrane protein G1P-rela... Lus10031835 2.0 0.8616
AT5G62220 ATGT18 glycosyltransferase 18 (.1) Lus10031685 2.4 0.8654
AT1G15550 ATGA3OX1, GA4 GA REQUIRING 4, ARABIDOPSIS TH... Lus10011476 4.2 0.8285
AT4G28230 unknown protein Lus10033724 6.0 0.8434
AT4G39840 unknown protein Lus10024058 6.9 0.8295
AT1G14360 ATUTR3, UTR3 UDP-galactose transporter 3 (.... Lus10030495 7.5 0.8357
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10026404 8.1 0.8517
AT1G26610 C2H2ZnF C2H2-like zinc finger protein ... Lus10004659 9.1 0.7752

Lus10032170 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.