Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1) AT5G18080 111 / 3e-33 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18020 111 / 4e-33 SAUR-like auxin-responsive protein family (.1) AT5G18030 108 / 3e-32 SAUR-like auxin-responsive protein family (.1) AT5G18050 108 / 4e-32 SAUR-like auxin-responsive protein family (.1) AT5G18060 108 / 6e-32 SAUR-like auxin-responsive protein family (.1) AT5G18010 107 / 1e-31 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1) AT2G21200 107 / 1e-31 SAUR-like auxin-responsive protein family (.1) AT4G34770 107 / 2e-31 SAUR-like auxin-responsive protein family (.1) AT4G38850 103 / 7e-30 SAUR-AC1, ATSAUR15, ATSR15AU, SAUR15, SAUR_AC1 SMALL AUXIN UP RNA 1 FROM ARABIDOPSIS THALIANA ECOTYPE COLUMBIA, ARABIDOPSIS COLUMBIA SAUR GENE 1, ARABIDOPSIS THALIANA SMALL AUXIN UPREGULATED 15, SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029198 [exp] 164 / 4e-54 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10027317 [exp] 162 / 3e-53 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 161 / 6e-53 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 161 / 6e-53 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 160 / 1e-52 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10008991 [exp] 150 / 2e-48 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 149 / 5e-48 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 149 / 5e-48 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10008992 [exp] 147 / 3e-47 AT2G21200 116 / 2e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 147 / 4e-47 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 138 / 1e-43 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 129 / 4e-40 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 129 / 6e-40 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 128 / 7e-40 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 128 / 7e-40 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 118 / 5e-36 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 115 / 1e-34 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 114 / 4e-34 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 110 / 7e-33 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10032173 pacid=23161198 polypeptide=Lus10032173 locus=Lus10032173.g ID=Lus10032173.BGIv1.0 annot-version=v1.0 ATGCCAGACCTGTCCAAAACAACAAGTTCATCATATCCATCAAGGAAAGCAGAGATCATTATGGCTATTGGTTTACCTGGTAATCTTGCTAAGCAAATTC TGCGGCGGACAGGATCAGGCTCGAACAGAGCAACATCAAGGTTTCCAGATGTTCCAACAGGATTCCTGGCAGTGTATGTTGGAGAGAACAGGAATAAGCG ATTTGTAGTTCCGGTATCCTACTTAAGCCAGCCTTCATTTCAGGATTTGCTGAGCATGGCTGAAGAGGAGTTTGGCTTTGATCATTCAATGGGTGGCTTG ACGATTCCCTGCAGTGAAGAGACATTTACTTGTGTAACCTCCATCTTGAGAAGATCATGA
AA sequence Show only first row Show all	>Lus10032173 pacid=23161198 polypeptide=Lus10032173 locus=Lus10032173.g ID=Lus10032173.BGIv1.0 annot-version=v1.0 MPDLSKTTSSSYPSRKAEIIMAIGLPGNLAKQILRRTGSGSNRATSRFPDVPTGFLAVYVGENRNKRFVVPVSYLSQPSFQDLLSMAEEEFGFDHSMGGL TIPCSEETFTCVTSILRRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10032173 [exp]	0	1
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Lus10014175 [exp]	1.7	0.9054
AT2G02000		GAD3	glutamate decarboxylase 3 (.1)		Lus10009116 [exp]	5.1	0.8684
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10036009 [exp]	6.5	0.8680
AT2G45460	FHA		SMAD/FHA domain-containing pro...		Lus10015860 [exp]	9.3	0.7519
					Lus10042808 [exp]	9.5	0.7822
					Lus10020900 [exp]	11.5	0.8062
					Lus10043057 [exp]	11.8	0.8169
					Lus10016852 [exp]	11.8	0.7671
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Lus10001465 [exp]	12.1	0.7801
AT1G55310		ATSCL33, SR33, ...	SC35-like splicing factor 33 (...		Lus10017299 [exp]	13.7	0.7858

Compare expression of checked genes

Lus10032173 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.