Lus10032183 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2)
AT3G28490 387 / 7e-136 Oxoglutarate/iron-dependent oxygenase (.1)
AT5G18900 360 / 2e-125 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G06300 346 / 1e-119 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1)
AT4G35810 265 / 4e-88 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G20270 262 / 8e-87 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G17720 261 / 2e-86 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G66060 258 / 3e-85 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT4G25600 219 / 5e-70 Oxoglutarate/iron-dependent oxygenase (.1)
AT2G43080 200 / 1e-62 AT-P4H-1 P4H isoform 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014502 520 / 0 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2)
Lus10012014 360 / 5e-125 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016271 357 / 7e-124 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10041857 261 / 3e-86 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10028404 261 / 3e-86 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10032184 255 / 3e-86 AT3G28480 206 / 2e-67 Oxoglutarate/iron-dependent oxygenase (.1.2)
Lus10005620 239 / 2e-77 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10017249 225 / 2e-71 AT1G20270 455 / 3e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10031048 204 / 9e-65 AT2G43080 406 / 7e-145 P4H isoform 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G075100 464 / 4e-166 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2)
Potri.008G197700 360 / 2e-125 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G075300 356 / 3e-124 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2)
Potri.005G108000 266 / 2e-88 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.005G245300 255 / 5e-84 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.007G060800 251 / 3e-82 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.012G142800 241 / 3e-78 AT4G25600 278 / 4e-93 Oxoglutarate/iron-dependent oxygenase (.1)
Potri.002G232100 205 / 1e-64 AT2G43080 456 / 4e-164 P4H isoform 1 (.1)
Potri.007G052600 181 / 3e-55 AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.009G091000 180 / 6e-55 AT4G33910 431 / 9e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0213 ShK-like PF01549 ShK ShK domain-like
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10032183 pacid=23161129 polypeptide=Lus10032183 locus=Lus10032183.g ID=Lus10032183.BGIv1.0 annot-version=v1.0
ATGGAGTTCCTGTCCGGCCTTCATTACCTAGGGCTTTCCCTCTGTTTCCTCTTGATTTCCCCCCGCCTTGCCCTCTCGGAAAAAATAGACAAGTCAGTGC
TGAGGTTGAACAGAGGCTTGTTCTCAAAATCCTTTGATCCCACCCGCGTCATTCAACTCTCCTGGCATCCAAGGGCCTTTCTGTACAAAGGATTTCTGTC
AGATGCGGAATGCGAGCACCTTAAGGACCTGGCGAGGGACTCGCTTGAGAAATCAATGGTGGCGGACAATGAATCGGGGAAGAGTATAGAGAGTGAAGTC
AGAACAAGCTCTGGAACTTTTCTTAGTAAAGCACAGGATGAAGTGGTAGCTGCGATCGAACAGAGGATTGCTGCCTGGACTTTCCTTCCTGTAGAAAATG
GAGAGGCGATTCAAATCCTACGCTATGAGCTTGGTCAGAAGTATGAGCCACATTTTGACTATTTCCATGACAAGGCTAATCAACAGCTCGGTGGACACCG
GATTGCCACTGTGTTGATGTATCTATCAGATGTAGCCAAGGGTGGGGAAACCGTGTTTCCCAATGCAGAGGGGAAGGATTCTCAACCAAAGGCCGATGAC
TGGTCTGATTGTGCAAAAGATGGTTATGCAGTGAAGCCTGAGAAGGGTGATGCTCTAATGTTCTTCAGTCTCCACCCTGATGCAACCACTGATCCAACCA
GTCTGCACGGGAGTTGCCCCGTTATAGAGGGAGAGAAGTGGTCTGCAACAAAGTGGATCCACGTCAGGTCATTCGAGGAATCCATATCGCAACCAAGAGA
AGGAGGTTGCAGCGACGAGAACGAGAACTGCGCGAAATGGGCCAAGGCAGGTGAGTGCGAGAAGAACCCGCAGTATATGGTTGGTTCTGATCAATTTTCG
GGATACTGTAGGAAGAGTTGCCAGGTTTGCTCATCTTAG
AA sequence
>Lus10032183 pacid=23161129 polypeptide=Lus10032183 locus=Lus10032183.g ID=Lus10032183.BGIv1.0 annot-version=v1.0
MEFLSGLHYLGLSLCFLLISPRLALSEKIDKSVLRLNRGLFSKSFDPTRVIQLSWHPRAFLYKGFLSDAECEHLKDLARDSLEKSMVADNESGKSIESEV
RTSSGTFLSKAQDEVVAAIEQRIAAWTFLPVENGEAIQILRYELGQKYEPHFDYFHDKANQQLGGHRIATVLMYLSDVAKGGETVFPNAEGKDSQPKADD
WSDCAKDGYAVKPEKGDALMFFSLHPDATTDPTSLHGSCPVIEGEKWSATKWIHVRSFEESISQPREGGCSDENENCAKWAKAGECEKNPQYMVGSDQFS
GYCRKSCQVCSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G28480 Oxoglutarate/iron-dependent ox... Lus10032183 0 1
AT4G16490 ARM repeat superfamily protein... Lus10038811 3.0 0.8282
AT5G41610 ATCHX18 cation/H+ exchanger 18, ARABID... Lus10017540 8.1 0.7986
AT5G56750 NDL1 N-MYC downregulated-like 1 (.1... Lus10001786 11.5 0.7857
AT3G56820 unknown protein Lus10012105 13.5 0.8197
AT4G01200 Calcium-dependent lipid-bindin... Lus10008731 14.7 0.7907
AT5G08060 unknown protein Lus10040513 18.0 0.8194
AT1G49850 RING/U-box superfamily protein... Lus10002113 25.4 0.7832
AT5G42660 Protein of unknown function (D... Lus10024684 27.2 0.7876
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Lus10008893 29.4 0.7992
AT3G47520 pNAD-MDH, MDH plastidic NAD-dependent malate... Lus10000275 29.7 0.7871

Lus10032183 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.