Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G28480 206 / 1e-67 Oxoglutarate/iron-dependent oxygenase (.1.2) AT3G28490 193 / 1e-62 Oxoglutarate/iron-dependent oxygenase (.1) AT5G18900 188 / 2e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G06300 175 / 2e-55 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1) AT4G25600 113 / 2e-31 Oxoglutarate/iron-dependent oxygenase (.1) AT1G20270 111 / 1e-30 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G17720 111 / 1e-30 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G35810 110 / 3e-30 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G66060 106 / 6e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT2G23096 98 / 2e-25 P4H13 prolyl 4-hydroxylase 13, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032183 [exp] 255 / 1e-86 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10014502 [exp] 239 / 3e-80 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10012014 [exp] 175 / 2e-55 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10016271 [exp] 169 / 4e-53 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014973 [exp] 122 / 2e-34 AT4G25600 211 / 9e-67 Oxoglutarate/iron-dependent oxygenase (.1) Lus10038855 [exp] 115 / 8e-32 AT4G25600 250 / 2e-81 Oxoglutarate/iron-dependent oxygenase (.1) Lus10041857 [exp] 105 / 4e-28 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10028404 [exp] 104 / 4e-28 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10005620 [exp] 101 / 2e-26 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G075100 [exp] 211 / 2e-69 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.008G197700 [exp] 168 / 9e-53 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G075300 [exp] 152 / 9e-47 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.012G142800 [exp] 129 / 2e-37 AT4G25600 278 / 4e-93 Oxoglutarate/iron-dependent oxygenase (.1) Potri.005G245300 [exp] 108 / 8e-30 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G108000 [exp] 108 / 2e-29 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.007G060800 [exp] 106 / 1e-28 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G027201 [exp] 104 / 2e-28 AT5G18900 204 / 3e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G091000 [exp] 96 / 6e-25 AT4G33910 431 / 9e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G296800 [exp] 91 / 5e-23 AT4G33910 441 / 6e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0213 [flax] [poplar] ShK-like PF01549 [flax] [poplar] ShK ShK domain-like
Representative CDS sequence Show only first row Show all	>Lus10032184 pacid=23161084 polypeptide=Lus10032184 locus=Lus10032184.g ID=Lus10032184.BGIv1.0 annot-version=v1.0 ATGTATCTATCAGATGTAGCCAAGGGTGGGGAAACCGTGTTTCCCCATGCAGAGGGGAAGGATTCTCAACTAAAGGCAGATGACTGGTCTGATTGTGCAA AAGATGGTTATTCGGTGAATCCTGAGAAGGGTGATGCCCTACTGTTCTTCAATCTCCACCCTGATGCAACCACTGATCCCACCAGTCTGCACGGGAGTTG CCCCGTTATAAAGGGGGAGAAGTGGTCAGCAACAAAGTGGATCCACGTCAGGTCATTCGATGAATCCATATCGCAACTGCAAGAAGGAGGTTGCAGCGAC GAGAGCGAGAAGTGCGAGAAATGGGCGAAGGAAGGTGAGTGCGAGAAGAACCCGCAGTATATGGTTGGTACTGATAAAATATTGGGATACTGTAGGAAGA GTTGCAAGGTATGA
AA sequence Show only first row Show all	>Lus10032184 pacid=23161084 polypeptide=Lus10032184 locus=Lus10032184.g ID=Lus10032184.BGIv1.0 annot-version=v1.0 MYLSDVAKGGETVFPHAEGKDSQLKADDWSDCAKDGYSVNPEKGDALLFFNLHPDATTDPTSLHGSCPVIKGEKWSATKWIHVRSFDESISQLQEGGCSD ESEKCEKWAKEGECEKNPQYMVGTDKILGYCRKSCKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G28480			Oxoglutarate/iron-dependent ox...		Lus10032184 [exp]	0	1
AT1G18010			Major facilitator superfamily ...		Lus10019527 [exp]	3.2	0.7166
AT3G08870			Concanavalin A-like lectin pro...		Lus10012509 [exp]	4.2	0.7778
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10039720 [exp]	4.5	0.7520
					Lus10038267 [exp]	14.1	0.7486
AT4G19170		CCD4, NCED4	carotenoid cleavage dioxygenas...		Lus10037286 [exp]	14.3	0.7278
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10032062 [exp]	15.9	0.7172
AT5G21090			Leucine-rich repeat (LRR) fami...		Lus10042755 [exp]	19.0	0.6968
AT2G15220			Plant basic secretory protein ...		Lus10001607 [exp]	20.7	0.7089
AT2G20900		DGK5, ATDGK5	diacylglycerol kinase 5 (.1.2....		Lus10018527 [exp]	23.6	0.7280
AT3G11620		BAS1	alpha/beta-Hydrolases superfam...		Lus10004214 [exp]	23.6	0.7236

Compare expression of checked genes

Lus10032184 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.