Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71400 68 / 1e-14 AtRLP12 receptor like protein 12 (.1) AT5G61240 66 / 4e-14 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) AT5G20480 66 / 5e-14 EFR EF-TU receptor (.1) AT5G25930 66 / 6e-14 Protein kinase family protein with leucine-rich repeat domain (.1) AT2G33170 64 / 3e-13 Leucine-rich repeat receptor-like protein kinase family protein (.1) AT3G43740 62 / 3e-13 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) AT3G05660 63 / 7e-13 AtRLP33 receptor like protein 33 (.1) AT4G04220 62 / 9e-13 AtRLP46 receptor like protein 46 (.1) AT5G46330 61 / 3e-12 FLS2 FLAGELLIN-SENSITIVE 2, Leucine-rich receptor-like protein kinase family protein (.1) AT2G01950 60 / 5e-12 VH1, BRL2 VASCULAR HIGHWAY 1, BRI1-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014500 [exp] 151 / 5e-44 AT3G47570 663 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030855 [exp] 134 / 4e-38 AT3G47570 790 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030903 [exp] 132 / 3e-37 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030638 [exp] 126 / 3e-35 AT3G47570 771 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030587 [exp] 125 / 1e-34 AT3G47570 776 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10022864 [exp] 113 / 5e-32 AT5G20480 158 / 1e-43 EF-TU receptor (.1) Lus10030854 [exp] 116 / 1e-31 AT3G47110 758 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10011387 [exp] 115 / 2e-31 AT3G47570 782 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10011386 [exp] 115 / 2e-31 AT3G47570 787 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G007866 [exp] 89 / 3e-22 AT3G47570 770 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.005G080000 [exp] 89 / 3e-22 AT3G47570 818 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.010G228300 [exp] 88 / 1e-21 AT3G47570 743 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.006G099100 [exp] 82 / 2e-19 AT3G47570 787 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G033700 [exp] 82 / 2e-19 AT3G47570 799 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G115900 [exp] 81 / 2e-19 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.011G102800 [exp] 79 / 1e-18 AT3G47570 862 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G033900 [exp] 79 / 1e-18 AT3G47570 786 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G145200 [exp] 77 / 6e-18 AT3G47570 793 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G034000 [exp] 77 / 8e-18 AT3G47570 827 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10032186 pacid=23161099 polypeptide=Lus10032186 locus=Lus10032186.g ID=Lus10032186.BGIv1.0 annot-version=v1.0 ATGGTAGTCACTGCCTTAAACTTGTCATCCCAGGGACTATATGGCCCTATCTCACCGCATGTTGGCAATCTCAGCTTCCTGAAAGTGTTGAATCTTTACA ACAGGGAAATACCTCCTGAAATCGGCTGCCTGGGCAGATTGCAACAGTTGGTGCTTTATAACAACTCGCTCAGTGGCAAGATCCCATCCAACATCTTAGG GTTCTCTGCTCTTATTGTATTTGATGTATATAATAATAAATTGGTGGGAGGACTGCCATGGCAGTTTGGCTTATTGAACAAACTCTGA
AA sequence Show only first row Show all	>Lus10032186 pacid=23161099 polypeptide=Lus10032186 locus=Lus10032186.g ID=Lus10032186.BGIv1.0 annot-version=v1.0 MVVTALNLSSQGLYGPISPHVGNLSFLKVLNLYNREIPPEIGCLGRLQQLVLYNNSLSGKIPSNILGFSALIVFDVYNNKLVGGLPWQFGLLNKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G71400		AtRLP12	receptor like protein 12 (.1)		Lus10032186 [exp]	0	1
AT1G77760		GNR1, NIA1	nitrate reductase 1 (.1)		Lus10035402 [exp]	9.3	0.7905
AT2G36660		PAB7	poly(A) binding protein 7 (.1)		Lus10027733 [exp]	37.3	0.7670
AT5G51220			ubiquinol-cytochrome C chapero...		Lus10032494 [exp]	132.7	0.7128
AT3G18270		CYP77A5P	"cytochrome P450, family 77, s...		Lus10020434 [exp]	186.0	0.7086

Compare expression of checked genes

Lus10032186 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.