Lus10032198 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53020 197 / 2e-65 RPL24B, STV1 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
AT2G36620 197 / 3e-65 RPL24A ribosomal protein L24 (.1)
AT2G44860 72 / 2e-16 Ribosomal protein L24e family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024560 219 / 7e-74 AT2G36620 238 / 2e-81 ribosomal protein L24 (.1)
Lus10006314 209 / 3e-69 AT2G36620 233 / 2e-78 ribosomal protein L24 (.1)
Lus10029583 209 / 6e-69 AT2G36620 232 / 4e-78 ribosomal protein L24 (.1)
Lus10008640 206 / 8e-69 AT2G36620 243 / 1e-83 ribosomal protein L24 (.1)
Lus10035584 206 / 1e-68 AT2G36620 241 / 5e-83 ribosomal protein L24 (.1)
Lus10014637 100 / 5e-28 AT2G36620 100 / 6e-28 ribosomal protein L24 (.1)
Lus10020552 77 / 3e-18 AT2G44860 240 / 2e-82 Ribosomal protein L24e family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G085300 204 / 2e-68 AT3G53020 199 / 2e-66 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.015G141900 202 / 1e-67 AT3G53020 196 / 3e-65 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139400 201 / 5e-67 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139500 201 / 5e-67 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.003G123101 193 / 8e-64 AT3G53020 218 / 8e-74 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.009G148500 72 / 2e-16 AT2G44860 248 / 1e-85 Ribosomal protein L24e family protein (.1.2)
Potri.004G187800 72 / 3e-16 AT2G44860 249 / 8e-86 Ribosomal protein L24e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0175 TRASH PF01246 Ribosomal_L24e Ribosomal protein L24e
Representative CDS sequence
>Lus10032198 pacid=23168700 polypeptide=Lus10032198 locus=Lus10032198.g ID=Lus10032198.BGIv1.0 annot-version=v1.0
ATGGTTTTGAAGACTGAGCTATGCCGTTTCAGCGGACAGAAGATTTACCCCGGCAGGGGAATCAGATTCATCCGATCTGATTCTCAGGTTTTCCTCTTTG
CCAACTCGAAATGTAAGAGGTACTTCCACAACCGTCTGAAGCCTTCCAAGCTTACCTGGACCGCCGTGTTCAGGAAGCAGCACAAGAAGGACATTGCTGC
TGAGGCTGTGAAAAAGAAGAGAAGAACCAACAAGAAGCCTTACTCGAGGTCCATCGTTGGTGCTTCCTTGGAGGTGATACAGAAGAGGAGGGCCGAAAAG
CCTGAAGTCCGAGATGCTGCTCGTGAAGCTGCCATTCGTGAAATCAAGGAGAGGATTAAGAAGACCAAGGATGAGAAGAAGGCGAAGAAGGCTGAAGTCT
CCAAGTCACAGAAGGGACAAGGTAAGGGTGGTATGCCTAGGGGTGCTGCACCAAAGGGCGGACCCAAGCTCGGCGGTGGCGGTGGAAAGCGATGA
AA sequence
>Lus10032198 pacid=23168700 polypeptide=Lus10032198 locus=Lus10032198.g ID=Lus10032198.BGIv1.0 annot-version=v1.0
MVLKTELCRFSGQKIYPGRGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAVFRKQHKKDIAAEAVKKKRRTNKKPYSRSIVGASLEVIQKRRAEK
PEVRDAAREAAIREIKERIKKTKDEKKAKKAEVSKSQKGQGKGGMPRGAAPKGGPKLGGGGGKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10032198 0 1
AT5G65860 ankyrin repeat family protein ... Lus10032850 2.0 0.8697
AT3G02080 Ribosomal protein S19e family ... Lus10020836 5.1 0.8561
AT1G55205 unknown protein Lus10032319 5.7 0.8147
AT3G16780 Ribosomal protein L19e family ... Lus10023387 6.5 0.8496
AT5G02960 Ribosomal protein S12/S23 fami... Lus10023172 6.6 0.8487
AT5G04600 RNA-binding (RRM/RBD/RNP motif... Lus10007730 7.5 0.8424
AT5G22610 F-box/RNI-like/FBD-like domain... Lus10025560 11.8 0.6922
AT1G21750 ATPDI5, ATPDIL1... ARABIDOPSIS THALIANA PROTEIN D... Lus10042721 12.0 0.7314
AT3G52570 alpha/beta-Hydrolases superfam... Lus10021315 12.0 0.8451
AT1G26880 Ribosomal protein L34e superfa... Lus10036750 12.2 0.8451

Lus10032198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.