Lus10032206 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62810 194 / 3e-58 Copper amine oxidase family protein (.1)
AT4G12280 179 / 2e-56 copper amine oxidase family protein (.1)
AT3G43670 183 / 2e-54 Copper amine oxidase family protein (.1)
AT4G12290 178 / 2e-52 Copper amine oxidase family protein (.1)
AT1G31690 117 / 9e-31 Copper amine oxidase family protein (.1)
AT1G31710 103 / 5e-26 Copper amine oxidase family protein (.1)
AT4G14940 100 / 9e-25 ATAO1 amine oxidase 1 (.1)
AT1G31670 92 / 8e-22 Copper amine oxidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024568 261 / 1e-83 AT1G62810 914 / 0.0 Copper amine oxidase family protein (.1)
Lus10032209 164 / 2e-47 AT4G12290 996 / 0.0 Copper amine oxidase family protein (.1)
Lus10024571 161 / 3e-46 AT4G12290 993 / 0.0 Copper amine oxidase family protein (.1)
Lus10021922 114 / 2e-29 AT4G14940 839 / 0.0 amine oxidase 1 (.1)
Lus10010542 110 / 2e-28 AT1G31710 753 / 0.0 Copper amine oxidase family protein (.1)
Lus10013356 104 / 1e-26 AT1G31690 499 / 5e-173 Copper amine oxidase family protein (.1)
Lus10026757 104 / 4e-26 AT1G31690 727 / 0.0 Copper amine oxidase family protein (.1)
Lus10004912 103 / 7e-26 AT1G31710 738 / 0.0 Copper amine oxidase family protein (.1)
Lus10010540 103 / 7e-26 AT1G31710 761 / 0.0 Copper amine oxidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G118200 211 / 8e-65 AT1G62810 961 / 0.0 Copper amine oxidase family protein (.1)
Potri.001G118300 187 / 6e-56 AT4G12290 1060 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G088900 112 / 8e-29 AT4G14940 904 / 0.0 amine oxidase 1 (.1)
Potri.010G088800 108 / 2e-27 AT1G31710 782 / 0.0 Copper amine oxidase family protein (.1)
Potri.008G151900 108 / 2e-27 AT1G31690 793 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G089050 107 / 4e-27 AT1G31710 780 / 0.0 Copper amine oxidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0103 Gal_mutarotase PF01179 Cu_amine_oxid Copper amine oxidase, enzyme domain
Representative CDS sequence
>Lus10032206 pacid=23168597 polypeptide=Lus10032206 locus=Lus10032206.g ID=Lus10032206.BGIv1.0 annot-version=v1.0
ATGGTGTTTGCTGGTTTGAATTTCCACAAGCGATTATTTGGTGAAGGTGTGTGGATGTTTGTCATTGTTGTAGAGAATTGGGATTCGGTGCTACCTTTCC
ATCAAGTTTCAGACAACACGAACCAAGTCCCGGACCAGGAAGAAGAAGGTCCTCTGGTGTTGGAGAACGTGATCGGAGTGGTGCACGACCACTGTGTCAC
GTTCCACCTAGACATGGACATGGATGGACCCAACAACACGTTCGTGAAGGTCAACTTGGTCAAGGAAGAGAACATACAGGGCAAAAATCCTAGGAAGAGC
TGCCTGAGGCCGAAGAGACACGTGGCGAAAACGGAGGAGGATGCTCGGATCAGGCTGAGCCTTTATGATCCGTCAGAGTTCCATGTCGTAAACCCTTCGA
GGAGGTCGAGACTCGGGAACCCTTCCGGGTACAAGGTCGTCCCCAGTGGGAATGCTGCTAGCTTGCTCGATCCTGATGATCCGCCTCAGTTGCGGAGTGC
TTTCACTAATAATCAGGTCGGACCATCTGAACTTAATCTGAGTTATAATTGA
AA sequence
>Lus10032206 pacid=23168597 polypeptide=Lus10032206 locus=Lus10032206.g ID=Lus10032206.BGIv1.0 annot-version=v1.0
MVFAGLNFHKRLFGEGVWMFVIVVENWDSVLPFHQVSDNTNQVPDQEEEGPLVLENVIGVVHDHCVTFHLDMDMDGPNNTFVKVNLVKEENIQGKNPRKS
CLRPKRHVAKTEEDARIRLSLYDPSEFHVVNPSRRSRLGNPSGYKVVPSGNAASLLDPDDPPQLRSAFTNNQVGPSELNLSYN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62810 Copper amine oxidase family pr... Lus10032206 0 1
AT3G61350 SKIP4 SKP1 interacting partner 4 (.1... Lus10017821 7.3 0.7353
AT3G54826 Zim17-type zinc finger protein... Lus10037983 21.8 0.6580
AT5G57860 Ubiquitin-like superfamily pro... Lus10036598 23.4 0.7073
AT5G55630 ATTPK1, ATKCO1 TWO PORE K CHANNEL 1, TWO PORE... Lus10000044 29.7 0.6921
AT5G64350 FKP12, ATFKBP12... ARABIDOPSIS THALIANA FK506-BIN... Lus10003760 34.9 0.7002
AT3G59280 TXR1 THAXTOMIN A RESISTANT 1, Prote... Lus10032532 35.9 0.7033
AT5G22060 ATJ2 ARABIDOPSIS THALIANA DNAJ HOMO... Lus10008652 38.8 0.6778
AT1G56450 PBG1 20S proteasome beta subunit G1... Lus10011640 42.2 0.6544
AT3G11591 unknown protein Lus10024722 45.5 0.6399
AT2G44525 Protein of unknown function (D... Lus10012187 53.0 0.6234

Lus10032206 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.