Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61110 145 / 2e-47 ARS27A ribosomal protein S27 (.1) AT2G45710 138 / 1e-44 Zinc-binding ribosomal protein family protein (.1) AT5G47930 137 / 3e-44 Zinc-binding ribosomal protein family protein (.1) AT3G61111 122 / 6e-38 Zinc-binding ribosomal protein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024576 [exp] 152 / 3e-49 AT3G61110 174 / 1e-57 ribosomal protein S27 (.1) Lus10035122 [exp] 148 / 2e-48 AT3G61110 176 / 2e-59 ribosomal protein S27 (.1) Lus10031974 [exp] 148 / 2e-48 AT3G61110 176 / 2e-59 ribosomal protein S27 (.1) Lus10031979 [exp] 148 / 2e-48 AT3G61110 173 / 2e-58 ribosomal protein S27 (.1) Lus10035128 [exp] 0 / 1 AT3G61110 84 / 1e-32 ribosomal protein S27 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G069100 [exp] 145 / 3e-47 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1) Potri.003G161200 [exp] 145 / 3e-47 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1) Potri.006G192900 [exp] 145 / 3e-47 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF01667 [flax] [poplar] Ribosomal_S27e Ribosomal protein S27
Representative CDS sequence Show only first row Show all	>Lus10032212 pacid=23168643 polypeptide=Lus10032212 locus=Lus10032212.g ID=Lus10032212.BGIv1.0 annot-version=v1.0 ATGGTGCTGCAAAACGATGTTGACTTGTTGAACCCACCGGCTGAGCTTGAGAAGAGGAAGCACAAGCTCAAGCGTCTCGTCCAATCTCCCAATTCCTTCT TCATGGATGTGAAGTGCCAAGGTTGCTTCAACATAACTACTGTGTTCAGCCACTCTCAAACTGTCGTAGTTTGCGGAAACTGCCAGAGTGTCCTGTGCCA GCCTACTGGAGGACGTGCTAGACTCACCGAGGGATGCTCCTTCCGGAGGAAGGCCGACTAA
AA sequence Show only first row Show all	>Lus10032212 pacid=23168643 polypeptide=Lus10032212 locus=Lus10032212.g ID=Lus10032212.BGIv1.0 annot-version=v1.0 MVLQNDVDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQSVLCQPTGGRARLTEGCSFRRKAD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10032212 [exp]	0	1
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Lus10015841 [exp]	1.4	0.9812
AT2G04400			Aldolase-type TIM barrel famil...		Lus10012310 [exp]	1.4	0.9680
AT5G24510			60S acidic ribosomal protein f...		Lus10028876 [exp]	2.4	0.9616
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10024576 [exp]	3.3	0.9569
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Lus10027800 [exp]	4.2	0.9649
AT4G39200			Ribosomal protein S25 family p...		Lus10023552 [exp]	4.2	0.9584
AT4G13850		ATGRP2, GR-RBP2	glycine rich protein 2, glycin...		Lus10032591 [exp]	4.9	0.9589
AT3G11510			Ribosomal protein S11 family p...		Lus10022693 [exp]	5.3	0.9604
AT5G56710			Ribosomal protein L31e family ...		Lus10015698 [exp]	6.3	0.9577
AT2G04400			Aldolase-type TIM barrel famil...		Lus10006354 [exp]	6.3	0.9627

Compare expression of checked genes

Lus10032212 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.