Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12300 184 / 6e-55 CYP706A4 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) AT4G12330 180 / 3e-53 CYP706A7 "cytochrome P450, family 706, subfamily A, polypeptide 7", cytochrome P450, family 706, subfamily A, polypeptide 7 (.1) AT4G12320 173 / 1e-50 CYP706A6 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) AT5G44620 169 / 4e-49 CYP706A3 "cytochrome P450, family 706, subfamily A, polypeptide 3", cytochrome P450, family 706, subfamily A, polypeptide 3 (.1) AT4G12310 163 / 5e-47 CYP706A5 "cytochrome P450, family 706, subfamily A, polypeptide 5", cytochrome P450, family 706, subfamily A, polypeptide 5 (.1) AT4G22710 149 / 7e-42 CYP706A2 "cytochrome P450, family 706, subfamily A, polypeptide 2", cytochrome P450, family 706, subfamily A, polypeptide 2 (.1) AT4G22690 150 / 1e-41 CYP706A1 "cytochrome P450, family 706, subfamily A, polypeptide 1", cytochrome P450, family 706, subfamily A, polypeptide 1 (.1) AT5G07990 135 / 2e-36 CYP75B1, D501, TT7 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) AT4G37310 125 / 1e-32 CYP81H1 "cytochrome P450, family 81, subfamily H, polypeptide 1", cytochrome P450, family 81, subfamily H, polypeptide 1 (.1) AT1G33730 118 / 5e-31 CYP76C5 "cytochrome P450, family 76, subfamily C, polypeptide 5", cytochrome P450, family 76, subfamily C, polypeptide 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024581 [exp] 339 / 6e-116 AT4G12300 395 / 5e-134 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10032215 [exp] 336 / 2e-113 AT4G12300 462 / 1e-158 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10032026 [exp] 328 / 1e-110 AT4G12300 464 / 1e-159 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10024578 [exp] 300 / 2e-99 AT4G12320 437 / 7e-149 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Lus10032214 [exp] 295 / 3e-97 AT4G12320 433 / 2e-147 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Lus10024577 [exp] 286 / 2e-94 AT4G12300 444 / 3e-152 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10032213 [exp] 285 / 4e-94 AT4G12300 453 / 1e-155 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10035196 [exp] 279 / 6e-93 AT4G12300 308 / 7e-101 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10024580 [exp] 273 / 3e-90 AT4G12310 344 / 2e-114 "cytochrome P450, family 706, subfamily A, polypeptide 5", cytochrome P450, family 706, subfamily A, polypeptide 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G118400 [exp] 225 / 2e-70 AT4G12300 429 / 9e-146 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Potri.001G118500 [exp] 196 / 1e-59 AT4G12320 627 / 0.0 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Potri.005G045800 [exp] 186 / 2e-55 AT4G12300 577 / 0.0 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Potri.003G114400 [exp] 181 / 2e-53 AT4G12320 495 / 1e-171 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Potri.012G137200 [exp] 155 / 5e-44 AT2G45550 374 / 1e-124 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Potri.013G073300 [exp] 147 / 6e-41 AT5G07990 711 / 0.0 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.001G113900 [exp] 134 / 3e-36 AT2G45550 496 / 1e-172 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Potri.015G138900 [exp] 131 / 3e-35 AT1G33720 359 / 6e-119 "cytochrome P450, family 76, subfamily C, polypeptide 6", cytochrome P450, family 76, subfamily C, polypeptide 6 (.1) Potri.012G136600 [exp] 129 / 1e-34 AT2G45560 360 / 3e-119 "cytochrome P450, family 76, subfamily C, polypeptide 1", cytochrome P450, family 76, subfamily C, polypeptide 1 (.1.2) Potri.001G025200 [exp] 125 / 4e-33 AT2G45550 322 / 2e-104 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10032216 pacid=23168591 polypeptide=Lus10032216 locus=Lus10032216.g ID=Lus10032216.BGIv1.0 annot-version=v1.0 ATGACAGTATCAAACACAATCCTGTCCATGCTCTGGGGAAGCACGATCCATGGCGAAGAAGGTGAAATGTTCTATTCCAAGATTAAGAAATTGTCGGATG AGCTTATGGTGCTACTTGCTGCACCAAACATCTCGGACCTTGTTCCTGCACTTGCCAGGTTTGACCTGCAGGGGATAGAGAAGAAATGCAGGAAGCTGCA ACAGGAATTCGATCGAATTTTCGATTCTGTCATCAGCGAGCGGAGGAATTCGGGAGGTGAAGTCAAAGATGTGAAGGACTACTTGCAGATTCTACTAGAC CTCAACAGCCATGGAGGAGATGCCGCATCATCAATCACAGACAGTCAACTCAAGGGATACGAGTGTCGGTGCAACAGACACAACATCAACGATAGAATGG ACAATGGCAATGCTGATGCAACATCCAGATGCAATGCAGAAGTGATTAAGGAAACATTCCGGCTGCATCCAGCACTGCCGATCCTGCTGCACCGTTATCC GAGCAAAGACTGCAAACTAGGAGGGTACACAATTCCAAAGGGCGTAACGGTATTCATTAAGGCTTACGCAATCCACAGGGATCCAAACCTCTGGACCAAC CCTCTGGAATTCAGACCCGAGAGGTTCCAAGAAGAGAGTGATGGAACCAAGTTCGATTACTTCGGCAAAGGTAATTGCCAGTATTTCCCATTCGGGACTG GGAGGAGGATCTGTGCGGGGATTCCATTAGCAGAGAAGATACGTCCTGGCATTGCTGCTCCACTTGTTTGA
AA sequence Show only first row Show all	>Lus10032216 pacid=23168591 polypeptide=Lus10032216 locus=Lus10032216.g ID=Lus10032216.BGIv1.0 annot-version=v1.0 MTVSNTILSMLWGSTIHGEEGEMFYSKIKKLSDELMVLLAAPNISDLVPALARFDLQGIEKKCRKLQQEFDRIFDSVISERRNSGGEVKDVKDYLQILLD LNSHGGDAASSITDSQLKGYECRCNRHNINDRMDNGNADATSRCNAEVIKETFRLHPALPILLHRYPSKDCKLGGYTIPKGVTVFIKAYAIHRDPNLWTN PLEFRPERFQEESDGTKFDYFGKGNCQYFPFGTGRRICAGIPLAEKIRPGIAAPLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10032216 [exp]	0	1
AT4G12320		CYP706A6	"cytochrome P450, family 706, ...		Lus10032217 [exp]	1.0	0.9609
AT3G24420			alpha/beta-Hydrolases superfam...		Lus10017735 [exp]	4.5	0.9394
AT3G45740			hydrolase family protein / HAD...		Lus10023480 [exp]	6.0	0.8831
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10015279 [exp]	6.3	0.9185
AT1G25270			nodulin MtN21 /EamA-like trans...		Lus10012693 [exp]	8.1	0.8932
AT5G18470			Curculin-like (mannose-binding...		Lus10003099 [exp]	8.7	0.9273
AT2G36800		UGT73C5, DOGT1	UDP-GLUCOSYL TRANSFERASE 73C5,...		Lus10003323 [exp]	9.2	0.9122
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10007674 [exp]	12.4	0.9141
AT5G19855		AtRbcX2	homologue of cyanobacterial Rb...		Lus10027363 [exp]	14.1	0.8974
AT3G60810			unknown protein		Lus10004025 [exp]	15.3	0.8804

Compare expression of checked genes

Lus10032216 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.