Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12300 99 / 1e-24 CYP706A4 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) AT4G12320 97 / 7e-24 CYP706A6 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) AT4G12330 94 / 7e-23 CYP706A7 "cytochrome P450, family 706, subfamily A, polypeptide 7", cytochrome P450, family 706, subfamily A, polypeptide 7 (.1) AT4G12310 92 / 3e-22 CYP706A5 "cytochrome P450, family 706, subfamily A, polypeptide 5", cytochrome P450, family 706, subfamily A, polypeptide 5 (.1) AT5G44620 87 / 2e-20 CYP706A3 "cytochrome P450, family 706, subfamily A, polypeptide 3", cytochrome P450, family 706, subfamily A, polypeptide 3 (.1) AT4G22710 77 / 4e-17 CYP706A2 "cytochrome P450, family 706, subfamily A, polypeptide 2", cytochrome P450, family 706, subfamily A, polypeptide 2 (.1) AT4G22690 76 / 1e-16 CYP706A1 "cytochrome P450, family 706, subfamily A, polypeptide 1", cytochrome P450, family 706, subfamily A, polypeptide 1 (.1) AT5G04330 72 / 3e-15 Cytochrome P450 superfamily protein (.1) AT4G36220 64 / 2e-12 CYP84A1, FAH1, F5H1 ferulic acid 5-hydroxylase 1 (.1) AT5G07990 63 / 3e-12 CYP75B1, D501, TT7 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032215 [exp] 182 / 2e-55 AT4G12300 462 / 1e-158 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10032026 [exp] 178 / 4e-54 AT4G12300 464 / 1e-159 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10024575 [exp] 141 / 9e-41 AT5G44620 267 / 2e-84 "cytochrome P450, family 706, subfamily A, polypeptide 3", cytochrome P450, family 706, subfamily A, polypeptide 3 (.1) Lus10032214 [exp] 142 / 3e-40 AT4G12320 433 / 2e-147 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Lus10024578 [exp] 140 / 1e-39 AT4G12320 437 / 7e-149 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Lus10024577 [exp] 139 / 3e-39 AT4G12300 444 / 3e-152 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10032211 [exp] 134 / 1e-37 AT4G12320 432 / 2e-147 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Lus10032213 [exp] 133 / 3e-37 AT4G12300 453 / 1e-155 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Lus10028914 [exp] 130 / 3e-36 AT4G12320 461 / 3e-158 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G118400 [exp] 119 / 5e-32 AT4G12300 429 / 9e-146 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Potri.003G114400 [exp] 117 / 3e-31 AT4G12320 495 / 1e-171 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Potri.001G118500 [exp] 94 / 5e-23 AT4G12320 627 / 0.0 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1) Potri.005G045800 [exp] 86 / 6e-20 AT4G12300 577 / 0.0 "cytochrome P450, family 706, subfamily A, polypeptide 4", cytochrome P450, family 706, subfamily A, polypeptide 4 (.1) Potri.008G223500 [exp] 74 / 7e-16 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G016400 [exp] 69 / 2e-14 AT4G36220 761 / 0.0 ferulic acid 5-hydroxylase 1 (.1) Potri.005G117500 [exp] 68 / 9e-14 AT4G36220 728 / 0.0 ferulic acid 5-hydroxylase 1 (.1) Potri.003G007900 [exp] 67 / 2e-13 AT4G37370 524 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.007G085000 [exp] 65 / 1e-12 AT5G07990 402 / 5e-135 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.001G365100 [exp] 64 / 3e-12 AT3G26300 347 / 2e-114 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10032217 pacid=23168587 polypeptide=Lus10032217 locus=Lus10032217.g ID=Lus10032217.BGIv1.0 annot-version=v1.0 ATGGCAATGGAGCTCCACAACCTATGGACACGGTGGAGCAACGACGGTTCGATACTTTCAATTGCAGCTCCCATCGCAGCACCGACCATGGCGATATGGT TACTCAAGAGAGCATCCAACAACACACCACCATTGCCACCGGGCCCACGTGGATTGCCAATAGTCGGGTGCCTGCCATTTCTAAGCACCCATCTCCACAA GAGCTTCACAGAGCTGGCCGAAACCTACGGCCCTGTCTACAAGCTCTGGCTCGGTTACAAGATGTATGTGGTGATCGGCTCGCCATCACTAGCTAAAGAC GTTTGTGACCAGGATGTAATATTTGCAGCTCGAAACCCTCCGATCGCTGTAAAGATCGCCCTCTATGGTGGGAATGACATGGCCTTCACGTCCTATGGCC CAGAGTGGAAGAAGCTGAGCAAGATCTTCGTGGGTGAGGTGCTAAGCATTGGAGGCTTGACGGTTCCTATGTGCTGA
AA sequence Show only first row Show all	>Lus10032217 pacid=23168587 polypeptide=Lus10032217 locus=Lus10032217.g ID=Lus10032217.BGIv1.0 annot-version=v1.0 MAMELHNLWTRWSNDGSILSIAAPIAAPTMAIWLLKRASNNTPPLPPGPRGLPIVGCLPFLSTHLHKSFTELAETYGPVYKLWLGYKMYVVIGSPSLAKD VCDQDVIFAARNPPIAVKIALYGGNDMAFTSYGPEWKKLSKIFVGEVLSIGGLTVPMC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12320		CYP706A6	"cytochrome P450, family 706, ...		Lus10032217 [exp]	0	1
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10032216 [exp]	1.0	0.9609
					Lus10030151 [exp]	1.4	0.9152
AT1G74150			Galactose oxidase/kelch repeat...		Lus10031420 [exp]	3.2	0.8931
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Lus10024353 [exp]	3.5	0.8950
AT5G10770			Eukaryotic aspartyl protease f...		Lus10020100 [exp]	5.5	0.9071
AT1G53440			Leucine-rich repeat transmembr...		Lus10038153 [exp]	8.4	0.8822
AT5G19855		AtRbcX2	homologue of cyanobacterial Rb...		Lus10027363 [exp]	8.8	0.8901
AT2G33460		RIC1	ROP-interactive CRIB motif-con...		Lus10011805 [exp]	8.9	0.8718
AT1G53440			Leucine-rich repeat transmembr...		Lus10042505 [exp]	10.7	0.8656
AT4G35270		NLP2	Plant regulator RWP-RK family ...		Lus10023930 [exp]	10.9	0.8664

Compare expression of checked genes

Lus10032217 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.