Lus10032225 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12340 98 / 4e-26 copper ion binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024588 238 / 4e-81 AT4G12340 131 / 4e-39 copper ion binding (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G114200 158 / 2e-49 AT4G12340 119 / 1e-34 copper ion binding (.1)
Potri.001G118700 154 / 4e-48 AT4G12340 124 / 2e-36 copper ion binding (.1)
PFAM info
Representative CDS sequence
>Lus10032225 pacid=23168501 polypeptide=Lus10032225 locus=Lus10032225.g ID=Lus10032225.BGIv1.0 annot-version=v1.0
ATGGAGAACTTTACACTTAAAATCACCAAGGAGCTTGTTGACCGTCTTACTGGCGATGAAGAGAACGCAAGGAAGAGAACAAGGAAACCGAAACCTAAAG
TACCAAAACAGCCTCAACAACCTCGAACAAAGTCAAACGTGAAGCCACTCCATGAAGAATCCAAGCCTCAGAAGGTGCCTGCTGCTCCCGGATGGCCAGT
TCAGCCTCCGATCTTCTTGCCCGCCCAACCGCCACCTGTCCATCCAGCCAGCGCGGAGCTCGATGCAATTCGATCAGTCGTTCAGGAGAGCGAAAAGGTT
CTTGAGAAGCTCCAGAAGCAGGAGGAACACATGGTGCAAGAAGTGACCGAAAGAGCCAAGGATTTGCACGGCAAGGAGTTCAAGCTTCCTTACCAAAAGC
CTATGCCCTGTGTGGCTGACTATGAAGCTTGCCGGTCTTGCTACAAGGAGCACATCAATGACATCCTCAGATGCAGCCCTCTCACCAAGAGCTACTACGA
ATGCGTCCAGAGAGTAAAACAGCAAGCTGGGCCCTCTGATAAGTAG
AA sequence
>Lus10032225 pacid=23168501 polypeptide=Lus10032225 locus=Lus10032225.g ID=Lus10032225.BGIv1.0 annot-version=v1.0
MENFTLKITKELVDRLTGDEENARKRTRKPKPKVPKQPQQPRTKSNVKPLHEESKPQKVPAAPGWPVQPPIFLPAQPPPVHPASAELDAIRSVVQESEKV
LEKLQKQEEHMVQEVTERAKDLHGKEFKLPYQKPMPCVADYEACRSCYKEHINDILRCSPLTKSYYECVQRVKQQAGPSDK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G12340 copper ion binding (.1) Lus10032225 0 1
AT4G12340 copper ion binding (.1) Lus10024588 1.0 0.9289
AT1G51450 ASH2R, TRO ARABIDOPSIS Ash2 RELATIVE, TRA... Lus10027355 2.6 0.8657
AT3G48680 AtCAL2, GAMMACA... gamma carbonic anhydrase-like ... Lus10031278 3.7 0.8961
AT1G61150 LisH and RanBPM domains contai... Lus10018464 4.2 0.8630
AT4G29870 Oligosaccharyltransferase comp... Lus10003228 5.5 0.8943
AT5G58290 RPT3 regulatory particle triple-A A... Lus10006854 5.7 0.8924
AT1G28120 unknown protein Lus10030429 6.6 0.8527
AT4G28730 GrxC5 glutaredoxin C5, Glutaredoxin ... Lus10011915 6.9 0.8681
AT5G23290 PFD5, PDF5 prefoldin 5 (.1) Lus10010176 7.6 0.7880
AT1G27310 NTF2A nuclear transport factor 2A (.... Lus10035202 7.7 0.8763

Lus10032225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.