Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70250 86 / 3e-20 receptor serine/threonine kinase, putative (.1) AT1G62790 79 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G73550 62 / 6e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G18280 62 / 9e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73560 61 / 2e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73890 48 / 2e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G13900 48 / 2e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 47 / 4e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44290 43 / 2e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 42 / 3e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024591 [exp] 196 / 5e-65 AT1G62790 100 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10031335 [exp] 59 / 7e-11 AT3G17910 414 / 3e-142 SURFEIT 1, EMBRYO DEFECTIVE 3121, Surfeit locus 1 cytochrome c oxidase biogenesis protein (.1) Lus10014681 [exp] 48 / 2e-07 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042984 [exp] 47 / 6e-07 AT1G73890 81 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032488 [exp] 46 / 1e-06 AT1G73890 84 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 44 / 6e-06 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 44 / 7e-06 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021604 [exp] 40 / 0.0002 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10042611 [exp] 39 / 0.0003 AT3G22600 142 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G119000 [exp] 96 / 4e-26 AT1G62790 90 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G113900 [exp] 94 / 3e-25 AT1G70250 73 / 9e-16 receptor serine/threonine kinase, putative (.1) Potri.013G131500 [exp] 65 / 5e-14 AT5G13900 122 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 45 / 2e-06 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 44 / 9e-06 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G036201 [exp] 42 / 3e-05 AT1G18280 96 / 3e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 40 / 0.0001 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G232000 [exp] 39 / 0.0004 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G053700 [exp] 38 / 0.0008 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G054000 [exp] 38 / 0.0008 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032228 pacid=23168615 polypeptide=Lus10032228 locus=Lus10032228.g ID=Lus10032228.BGIv1.0 annot-version=v1.0 ATGGCTTCCACCTCCTTGTCCACCACGGCGGCACTCATCGTCCTCCTGGCCATCACAGCGATCACTGTCACCGAAGCTCAGGGAAACGCTGGTAGCAACA TTCCGTCCTGCGCCTCGAAGCTAGTCCCCTGCGCGCAGTACATCGCCAACACCACCGAGAAGCCACCGGCGACCTGCTGCGACCCGATCAAGGAGACCGT TAAAACCGAGCTCACTTGCCTCTGCAACCTCTACAACACTCCCGGATTTCTCGCCTCATTGGGGATCAACGTCACCCAGGCCGTTGGCCTCACCACTCGC TGCGGAATCAGCGCCGACACCAGCTCCTGCAGCAAAGCGACGGAGAACACCAACAGCAACAGCAACAGTGGAAGCAGCAAGATGGCATGGGCTGGATTCT CAAGCATGCTCTTGATATTTGCTGCCTCGTCGTTCTTTTAG
AA sequence Show only first row Show all	>Lus10032228 pacid=23168615 polypeptide=Lus10032228 locus=Lus10032228.g ID=Lus10032228.BGIv1.0 annot-version=v1.0 MASTSLSTTAALIVLLAITAITVTEAQGNAGSNIPSCASKLVPCAQYIANTTEKPPATCCDPIKETVKTELTCLCNLYNTPGFLASLGINVTQAVGLTTR CGISADTSSCSKATENTNSNSNSGSSKMAWAGFSSMLLIFAASSFF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G70250			receptor serine/threonine kina...		Lus10032228 [exp]	0	1
					Lus10010492 [exp]	6.3	0.8557
AT1G07400			HSP20-like chaperones superfam...		Lus10016457 [exp]	8.1	0.8634
AT4G24510		VC2, VC-2, CER2	ECERIFERUM 2, HXXXD-type acyl-...		Lus10028171 [exp]	14.7	0.8836
AT4G15415		ATB'GAMMA, ATB'...	Protein phosphatase 2A regulat...		Lus10025085 [exp]	16.3	0.8519
AT5G46930			Plant invertase/pectin methyle...		Lus10040119 [exp]	19.6	0.8818
AT1G11120			unknown protein		Lus10011221 [exp]	37.5	0.7833
AT1G48635		PEX3-2, PEX3	PEROXIN 3-2, peroxin 3 (.1.2)		Lus10009676 [exp]	38.5	0.7482
AT1G67570			Protein of unknown function (D...		Lus10043011 [exp]	39.0	0.8370
AT2G10940			Bifunctional inhibitor/lipid-t...		Lus10027704 [exp]	46.5	0.8585
AT4G14380			unknown protein		Lus10011818 [exp]	54.4	0.7959

Compare expression of checked genes

Lus10032228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.